KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_30850Help
Entry
GTCCBUS3UF5_30850 CDS       T01676                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_30850
   00030 Pentose phosphate pathway
    GTCCBUS3UF5_30850
   00051 Fructose and mannose metabolism
    GTCCBUS3UF5_30850
   00052 Galactose metabolism
    GTCCBUS3UF5_30850
  Energy metabolism
   00680 Methane metabolism
    GTCCBUS3UF5_30850
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    GTCCBUS3UF5_30850
Enzymes [BR:gte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GTCCBUS3UF5_30850
Protein phosphatases and associated proteins [BR:gte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GTCCBUS3UF5_30850
Messenger RNA biogenesis [BR:gte03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GTCCBUS3UF5_30850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2835142..2836161)
Genome map
AA seq 339 aa AA seqDB search
MFKKTYEVGRVQFDANEVEMMKRIGVLTSGGDSPGMNAAIRAVVRKAIYHGVEVYGIYHG
YAGLIAGNIKKLEVGDVGDIIHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVI
GGDGSYQGAKKLTEHGFPCVGVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSH
ERTYVVEVMGRHAGDIALWSGLAGGAETILIPEADYDMDDIIARLKRGHERGKKHSIIIV
AEGVGSGVDFGRQIQEATGFETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKG
GRCVGIQNNQIVDHDIAEALAKTHTVDQRMYTLSKELSI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagaagacgtatgaggtcggacgtgtgcaattcgatgcaaacgaggtggaaatg
atgaaacggattggtgtgttgacaagcggcggcgactcgccgggcatgaatgcggccatt
cgcgctgtcgtccgcaaagcgatttaccatggggtggaagtgtacggaatctaccacggg
tatgccgggttgatcgccggcaatatcaaaaaactggaagtcggggacgtcggggacatc
atccatcgcggcggcaccatcctttataccgcgcgctgcccggagtttaagacggaagaa
ggacagaaaaaggggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacgggtcgtatcaaggggcgaaaaaattgacggagcacggcttcccgtgcgtc
ggcgtgcccgggacgatcgacaacgacattccaggcaccgattttacgatcggttttgac
accgcgctcaatacggtcattgacgccattgacaaaatccgcgacacggcgacgtcgcat
gagcggacgtacgtcgtcgaagtgatgggccgccatgccggcgatattgcgctatggtcg
gggcttgccggaggggcggagacgattttgattccggaagcggactacgacatggacgac
atcatcgctcgcttgaagcgcggccatgaacgcggcaaaaaacacagcatcatcatcgtc
gccgagggagtcggcagcggcgtcgacttcggccggcaaattcaagaggcgaccggcttt
gagacgcgcgtgacggtgcttggccacgtgcagcgcggcggatcgccgacggcgtttgac
cgcgtgttagcgagccgcctcggcgcccgtgcggtcgagctgctccttgaaggcaaaggc
ggccgctgcgttggcattcaaaacaaccaaatcgttgaccatgacattgccgaagcgttg
gcgaaaacacatacggtcgatcagcggatgtatacattgtcgaaagagctgtcgatttaa

DBGET integrated database retrieval system