KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_32600Help
Entry
GTCCBUS3UF5_32600 CDS       T01676                                 

Definition
(GenBank) Protein-glutamine gamma-glutamyltransferase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Brite
Enzymes [BR:gte01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GTCCBUS3UF5_32600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3012144..3012962
Genome map
AA seq 272 aa AA seqDB search
MIRVLSPINFDVSSSFSLPASEQRILDALVSSPKLYTYANKHQLRFEIALRDRIVRAAGE
LAKSRARFAIFRFSRCNSDFWTRDERGGFRLRPDVTASEAIQDIFVHSERYAFECATAIV
IVFYKAVLDVIDPAAFNRLFADLLLYDWHTDRDLGIQTKKDEHFLPGDCLYFKNPEFDPL
TPQWQGENAIYLGDGFFYGHGIGIQTKEGIIAALNRKRKRGATKSAYLLPDITQVDFAYL
SQFARGFDEFRLPIRRSSFIFGTLGSAAFLHR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgattcgcgtgttatcaccaatcaactttgacgtttctagttcgttttcgcttccggcc
agcgaacaacgaatcttagatgcccttgtttcctcgcctaagttgtatacgtatgcaaat
aaacaccagcttcgatttgaaatcgccttgcgcgaccgcattgttcgggcggcgggcgag
ttggcgaaaagccgggcgcggtttgccattttccgtttttcgcgctgcaacagcgatttt
tggacgcgggacgagcgcggcggcttccgtcttcgcccagatgtcacggcttccgaagcg
attcaggacatttttgtccatagcgagcgatacgcgtttgaatgcgcgaccgcgatcgtc
atcgtgttttacaaggccgtgcttgacgtaatcgatccagcggcattcaaccggctgttt
gcggatttgctgctgtatgactggcataccgaccgggatcttggcattcaaacaaaaaaa
gatgaacactttctccccggagattgcctctattttaaaaacccggaattcgatccgttg
acgccgcaatggcaaggggaaaatgccatttacttaggcgacggcttcttttacgggcat
ggcatcggcattcaaacaaaggagggcatcatcgccgcgctcaatcgaaaacgaaagcgg
ggagccacgaaatccgcttacctgcttcccgatatcacgcaagtcgatttcgcttatttg
tcccaattcgcccgcggcttcgatgaattccgcctgccgatccgccgctcttcctttatc
tttggaacgctagggtccgctgcgttcttgcaccgttag

DBGET integrated database retrieval system