KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_8140Help
Entry
GTCCBUS3UF5_8140  CDS       T01676                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GTCCBUS3UF5_8140
  Lipid metabolism
   00071 Fatty acid degradation
    GTCCBUS3UF5_8140
  Amino acid metabolism
   00350 Tyrosine metabolism
    GTCCBUS3UF5_8140
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GTCCBUS3UF5_8140
   00626 Naphthalene degradation
    GTCCBUS3UF5_8140
Enzymes [BR:gte01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GTCCBUS3UF5_8140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(775312..776322)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVHKFKQKLQIEEVEKPKLGYGEVLVKIEACGVCHTDLHAAHGDWPVKPKLPLIPG
HEGVGIVVEIGEGVKSIQIGDRVGIPWLYSACGECEYCLSGQETLCPHQLNGGYSVDGSY
AEYCKAPANYVARIPKNLDPVQVAPILCAGVTTYKALKVSNAKPGEWVAIYGIGGLGHIA
LQYAKAMGLNVVAVDISDEKAELAAKLGADITINGLQEDPVAAIREKVGGVQAAISVAVT
KKAFEQAYQSVRRGGCLVIVGLPHDELPIPIFDTVLNGVTIKGSIVGTRKDMQEALDFAA
RGKVRPIVEAVPLEKINEVFERMEKGQINGRVVLTM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgttgttcacaaattcaagcaaaaacttcaaattgaagaagtggagaaa
ccaaaactaggatatggcgaagtgcttgtgaaaattgaagcttgtggcgtctgccatacc
gatttgcatgcggctcatggggattggccggtaaaaccgaaacttccacttattcctggt
catgaaggggtaggaattgttgttgagatcggtgagggagtgaaatcaatccaaattggc
gaccgtgttggcattccatggttatactcagcatgcggtgaatgtgaatattgtttaagc
ggtcaagaaacactttgtccacatcaattaaacggtggatactctgtcgatggcagttat
gcagaatattgcaaagccccggccaattatgtcgcacgaattcctaaaaacctcgatccc
gtacaagttgctcctattctttgtgctggggtcacaacgtataaagcattaaaagtttca
aatgccaagcctggcgaatgggtcgctatttatggaatcgggggattgggccatattgct
cttcaatatgccaaggcaatgggattaaatgttgttgctgttgatatcagtgatgaaaag
gcagaacttgcggcaaagttgggtgctgatattacgatcaatggattgcaagaagaccct
gtagcagccattcgtgaaaaagtaggcggagtacaagcggctattagcgttgctgtaacg
aaaaaagcgttcgaacaagcttatcaatccgtgcgacgcggcggctgccttgtcatagtt
ggactgcctcacgatgaactgccgattcctatttttgacactgtattaaatggcgttacg
ataaaaggttcgatcgtcggtacacgaaaagatatgcaagaagctctagatttcgccgca
cgcggaaaagttcgccctattgtggaagcggtaccattagaaaaaattaacgaagtattt
gaacggatggaaaaaggtcaaatcaatggccgcgttgttttaacaatgtaa

DBGET integrated database retrieval system