KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_1219Help
Entry
Geoth_1219        CDS       T01531                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Brite
Enzymes [BR:gth01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Geoth_1219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N AHSP
Motif
Other DBs
NCBI-ProteinID: AEH47214
LinkDB All DBs
Position
1170733..1171347
Genome map
AA seq 204 aa AA seqDB search
MAFELPQLPYAYDALEPYIDKETMNIHHTKHHNTYVTNLNAALEGHADLQNKSLEELLSN
LEALPESIRTAVRNNGGGHANHSLFWTILSPNGGGEPTGELAEAINKKFGSFAAFKEEFT
KAATTRFGSGWAWLVVNNGELEVTSTPNQDSPLMEGKTPILGLDVWEHAYYLKYQNRRPE
YIAAFWNIVNWDEVAKRYSEAKAK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaattgccacaattaccttatgcttatgatgcgcttgagccgtatatcgac
aaagaaacgatgaacattcaccacacgaaacaccataacacttatgtaacaaacttaaat
gctgctttagaaggacatgcggatttacaaaataaatcgcttgaagaattgctcagcaat
ttagaagcacttccggaaagcatccgcacagcagtccgcaacaacggcggcgggcacgca
aaccattctctcttctggacgattctttcgccaaacggtggcggcgagccaacgggagaa
ttagcggaagccattaacaaaaaattcggcagctttgcagcgttcaaagaagaatttaca
aaagcagcgacgactcgcttcggttccggatgggcttggctcgttgtcaacaacggcgaa
cttgaagtgacaagcacgccaaaccaagactcgccattgatggaaggaaaaactccgatt
cttggcttagacgtttgggaacatgcttattatttgaaatatcaaaaccgtcgtccagaa
tatattgcagcattctggaacatcgtgaactgggatgaagtagcaaaacgctacagcgaa
gcaaaagcgaaataa

DBGET integrated database retrieval system