KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_00580Help
Entry
GT3570_00580      CDS       T04710                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Brite
Translation factors [BR:gtk03012]
 Eukaryotic Type
  Elongation factors
   GT3570_00580 (tuf)
 Prokaryotic Type
   GT3570_00580 (tuf)
Mitochondrial biogenesis [BR:gtk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GT3570_00580 (tuf)
Exosome [BR:gtk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GT3570_00580 (tuf)
  Exosomal proteins of breast cancer cells
   GT3570_00580 (tuf)
  Exosomal proteins of colorectal cancer cells
   GT3570_00580 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
107604..108791
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccacgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggg
aaagccgaagcaaaagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcggg
attacgatttcgacggcgcacgtcgagtatgaaacagatgctcgccactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtctcggcggctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgttccgtacatcgttgtattcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccaggcgatgaagtgccggtcatcaaaggttcggcattaaaagcgcttgaa
ggcgacccgcaatgggaagaaaaaatcattgaactgatgaatgcggttgacgaatacatc
ccgacgccgcaacgtgaagtggacaaaccgttcatgatgccaatcgaggacgtcttctcg
atcacgggccgcggtacggttgcaacaggccgtgttgaacgcggtacgttgaaagttggc
gacccggttgaaatcatcggtttgtcggatgagccgaaaacgacgaccgttacgggtgta
gaaatgttccgcaaacttctcgatcaagcggaagctggcgacaacatcggtgcgcttctc
cgcggcgtatctcgtgatgaagtcgagcgcggccaagtattggcgaaacctggttcgatc
acgccgcacacgaaattcaaagcgcaagtatacgtcctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacgacggacgtaacg
ggcattatcacgcttccggaaggcgtcgaaatggttatgcctggcgacaacgttgaaatg
acggtggaactgatcgccccgatcgcgatcgaagaaggtacgaaattctcgatccgcgaa
ggcggccgtacggtcggcgctggctctgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system