KEGG   Geobacillus thermoleovorans KCTC 3570: GT3570_15520Help
Entry
GT3570_15520      CDS       T04710                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
gtk  Geobacillus thermoleovorans KCTC 3570
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GT3570_15520
Enzymes [BR:gtk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     GT3570_15520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3075817..3077466
Genome map
AA seq 549 aa AA seqDB search
MLTFHRIIRKGWMFLLAFLLTASLFCPTGQPAKAAAPFNGTMMQYFEWYLPDDGTLWTKV
ANEANNLSSLGITALWLPPAYKGTSRSDVGYGVYDLYDLGEFNQKGTVRTKYGTKAQYLQ
AIQAAHAAGMQVYADVVFDHKGGADGTEWVDAVEVNPSDRNQEISGTYQIQAWTKFDFPG
RGNTYSSFKWRWYHFDGVDWDESRKLSRIYKFRGIGKAWDWEVDTENGNYDYLMYADLDM
DHPEVVTELKNWGKWYVNTTNIDGFRLDAVKHIKFSFFPDWLSYVRSQTGKPLFTVGEYW
SYDINKLHNYITKTDGTMSLFDAPLHNKFYTASKSGGAFDMRTLMTNTLMKDQPTLAVTF
VDNHDTEPGQALQSWVDPWFKPLAYAFILTRQEGYPCVFYGDYYGIPQYNIPSLKSKIDP
LLIARRDYAYGTQHDYLDHSDIIGWTREGVTEKPGSGLAALITDGPGGSKWMYVGKQHAG
KVFYDLTGNRSDTVTINSDGWGEFKVNGGSVSVWVPRKTTVSTIARPITTRPWTGEFVRW
TEPRLVAWP
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
gtgctaacgtttcaccgcatcattcgaaaaggatggatgttcctgctcgcgtttttgctc
actgcctcgctgttctgcccaacaggacagcccgccaaggctgccgcaccgtttaacggc
accatgatgcagtattttgaatggtacttgccggatgatggcacgttatggaccaaagtg
gccaatgaagccaacaacttatccagccttggcatcaccgctctttggctgccgcccgct
tacaaaggaacaagccgcagcgacgtagggtacggagtatacgacttgtatgacctcggc
gaattcaatcaaaaagggaccgtccgcacaaaatacggaacaaaagctcaatatcttcaa
gccattcaagccgcccacgccgctggaatgcaagtgtacgccgatgtcgtgttcgaccat
aaaggcggcgctgacggcacggaatgggtggacgccgtcgaagtcaatccgtccgaccgc
aaccaagaaatctcgggcacctatcaaatccaagcatggacgaaatttgattttcccggg
cggggcaacacctactccagctttaagtggcgctggtaccattttgacggcgttgattgg
gacgaaagccgaaaattgagccgcatttacaaattccgcggcatcggcaaagcgtgggat
tgggaagtagacacggaaaacggaaactatgactacttaatgtatgccgaccttgatatg
gatcatcccgaagtcgtgaccgagctgaaaaactgggggaaatggtatgtcaacacaacg
aacattgatgggttccggcttgatgccgtcaagcatattaagttcagtttttttcctgat
tggttgtcgtatgtgcgttctcagactggcaagccgctatttaccgtcggggaatattgg
agctatgacatcaacaagttgcacaattacattacgaaaacagacggaacgatgtctttg
tttgatgccccgttacacaacaaattttataccgcttccaaatcagggggcgcatttgat
atgcgcacgttaatgaccaatactctcatgaaagatcaaccgacattggccgtcaccttc
gttgataatcatgacaccgaacccggccaagcgctgcagtcatgggtcgacccatggttc
aaaccgttggcttacgcctttattctaactcggcaggaaggatacccgtgcgtcttttat
ggtgactattatggcattccacaatataacattccttcgctgaaaagcaaaatcgatccg
ctcctcatcgcgcgcagggattatgcttacggaacgcaacatgattatcttgatcactcc
gacatcatcgggtggacaagggaaggggtcactgaaaaaccaggatccgggctggccgca
ctgatcaccgatgggccgggaggaagcaaatggatgtacgttggcaaacaacacgctgga
aaagtgttctatgaccttaccggcaaccggagtgacaccgtcaccatcaacagtgatgga
tggggggaattcaaagtcaatggcggttcggtttcggtttgggttcctagaaaaacgacc
gtttctaccatcgctcggccgatcacaacccgaccgtggactggtgaattcgtccgttgg
accgaaccacggttggtggcatggccttga

DBGET integrated database retrieval system