KEGG   Geobacillus thermocatenulatus: GT3921_02060Help
Entry
GT3921_02060      CDS       T05178                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm00240  Pyrimidine metabolism
gtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    GT3921_02060
Enzymes [BR:gtm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     GT3921_02060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ASS97946
UniProt: G1UIU3
LinkDB All DBs
Position
399065..399688
Genome map
AA seq 207 aa AA seqDB search
MYVMTQSGWLEVICGCMFSGKSEELIRRVRRAQFAKQEVKVFKPTIDNRYSEDEVVSHNG
NSVIAIPVATPAEMFRYISATTDVVAIDEVQFFSNDIIDVVQTLADGGCRVIAAGLDQDF
RGEPFGPVPALMAIAESVTKLEAVCTVCGSPASRTQRLINGAPASYDDPVILVGASEAYE
PRCRHHHEVPGKPKKRYNRPLAGHTGE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgatgacgcagtccggctggcttgaggtcatttgtggatgcatgttttccggc
aaatcagaagaattgattcgccgcgtccgccgcgctcagtttgccaagcaggaagtgaaa
gtgttcaaaccgacgatcgacaatcgctacagcgaagacgaagttgtatcgcacaacggc
aattcagtgatcgccattccggtcgcgacgccggcggaaatgttccgctacatttccgcc
accaccgacgtcgtcgccatcgatgaggtacagtttttttccaacgacatcatcgatgtg
gtgcaaacgctcgctgatggcggctgccgcgtcatcgccgcggggctcgaccaagatttt
cgcggtgaaccgtttggccccgtgccggcgctgatggcgatcgcggagtcggtgacgaag
ctggaggcggtttgcacggtatgcggttccccggccagccggacgcagcggctcattaac
ggtgcgcccgcctcttatgacgatccggtgattcttgtcggcgccagcgaggcgtacgag
cctcgctgccgtcatcaccatgaagtgcctggcaaaccgaaaaagcgatacaaccgcccg
cttgctggacatacgggtgagtga

DBGET integrated database retrieval system