KEGG   Geobacillus thermodenitrificans: GTNG_0885Help
Entry
GTNG_0885         CDS       T00496                                 

Definition
(GenBank) Oxoglutarate dehydrogenase
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
gtn00020  Citrate cycle (TCA cycle)
gtn00310  Lysine degradation
gtn00380  Tryptophan metabolism
gtn01100  Metabolic pathways
gtn01110  Biosynthesis of secondary metabolites
gtn01120  Microbial metabolism in diverse environments
gtn01130  Biosynthesis of antibiotics
gtn01200  Carbon metabolism
Module
gtn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
gtn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GTNG_0885
  Amino acid metabolism
   00310 Lysine degradation
    GTNG_0885
   00380 Tryptophan metabolism
    GTNG_0885
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     GTNG_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABO66263
UniProt: A4ILQ9
LinkDB All DBs
Position
959441..962221
Genome map
AA seq 926 aa AA seqDB search
MYEQYLDDPDSVDPELKQLFEQWGAPVVEEPVSPADPEATQTHQTFRLPETPTVFSKLVA
AVKLADSIRHYGHLAADTNPIVKKEKKLRRLELDEYDLTEEDLKRIPVAFLCPHAPAHVK
NGWDAILHLRKIYTDKIAFEFSQVHNLEERNWLIQQIESGAYYPSLANKERVALLRRLTE
VEGFEKFIHRTYVGQKRFSIEGLDSMVPLLDELVRQAIEHEIDAVNIGMAHRGRLNVLAH
VLGKPYEMIFAEFQHAESKNFIPSEGAVAITYGWTGDVKYHLGAARRLRNKSAHTMRITL
ANNPSHLEVVNPVVLGYTRAAQEDRTKPGVPEQKVDASFAILIHGDAAFPGQGVVAETLN
LSQLRGYTTGGAIHIIANNMIGFTTESYDSRSTTYASDMAKGFEVPIVHVNADDPEACLA
AASLAFAYRQRFKKDFVIDLIGYRRFGHNEMDEPMATNPLMYSIIHQHPTVRQLYAQKLI
DKGIIAEREVEEMEQEVAERLKIAYERVPKNEEELDFIMDPPKPVVDRLPEVKTGVAKDV
LHRINEELLEFPADFHVFNKLERILKRRSNVFAQNGKIDWAHAETLAFATILQDGVPIRL
TGQDSQRGTFAQRHLVLHDVKTGKEYVPLHHISGAKASFVVYNSPLTEAAVLGYEYGYNV
YAPETLVLWEAQFGDFANMAQVMFDQFISSGRAKWGQKSGLVMLLPHGYEGQGPEHSSGR
IERFLQLAAENNWTVANLSTAAQYFHILRRQAALLKKEEVRPLVLMTPKSLLRHPLASSE
AEALVQGAFSPVLEQPGLGVDASKVERIVFGTGKLMIDLAEQIGKMDGLDWLHVVRVEEL
YPFPEEAVQAIIARYPNVKELVWVQEEPKNMGAWMYMEPRLRAIAPEGVDVSYIGRRRRA
SPAEGDPVVHRKEQERIIRCALTKHE
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgtatgagcagtacctcgatgacccagacagcgtcgacccggaactaaaacaactgttt
gaacagtggggagcgccggtcgtcgaggaaccggtttctcctgcggatcccgaagcgacg
cagacgcatcaaacgttccggctgcctgagacaccaactgtatttagcaaacttgtcgcc
gccgtcaaactggcggacagcattcgccattatggccatctggccgccgatacgaaccca
atcgttaaaaaggagaaaaagttgcgccgtctcgaactagatgagtatgatttgacagaa
gaagatttaaagcgcattccggtcgcatttctttgtccacatgcgccggcgcacgttaaa
aacggttgggatgccattttgcacttgcgtaaaatctatacagataaaatcgcctttgaa
ttctcgcaagtacataatttagaggaaaggaactggctcatccagcaaatcgagtctgga
gcgtactatccgagcttggcgaacaaagagcgggtcgctttgctgcgtcgcctgacggaa
gtagaggggtttgaaaagttcattcatcggacatatgtcgggcaaaagcggttttcgatt
gagggtcttgactccatggtaccgcttctcgatgaacttgtccgtcaagcgattgagcat
gagattgatgctgtcaacatcggcatggcgcaccgcggccggctaaacgtgctcgcccat
gtgctcggtaagccgtatgaaatgattttcgctgagtttcagcatgcagaaagcaaaaac
tttattccgtccgaaggggcggtggccatcacctacggctggacgggtgacgtgaaatac
catttgggagcggcgcgccgtctgcgcaataaaagcgcgcatacgatgcgaattacgctc
gccaacaacccgagccatcttgaagttgtgaatccggtcgtgctcggctacacgcgcgct
gcacaagaagaccggacgaagccaggcgtgccggagcaaaaggtagacgcctcgtttgct
attttaattcatggcgatgctgccttcccggggcaaggtgttgtggctgagacgctcaac
ttaagccagttgcgcggctatacgaccggcggggcaattcatattatcgccaacaacatg
atcggctttacgacggaaagttacgattcccgttcgacaacgtatgcttccgatatggcg
aaagggtttgaggtgccgattgtgcacgtcaacgccgatgatccggaggcttgtttagca
gcggcaagcttggcgtttgcatatcgccagcgatttaaaaaagattttgttatcgacttg
atcggttatcgccgcttcggccataacgagatggatgagccgatggcgacgaatccgctc
atgtatagcatcattcaccagcatccgaccgtgcggcagctgtatgcgcaaaaattgatt
gataagggcatcatcgctgagcgggaagtcgaagaaatggagcaggaagtggccgaacgg
ttgaaaattgcctatgagcgggtgccgaaaaacgaagaggaactcgatttcattatggat
ccaccgaaaccggtcgtcgaccggctgccggaagtaaaaacaggtgtggcaaaagacgtg
cttcaccgcatcaatgaggagctactcgagttcccggctgacttccatgtctttaacaag
cttgagcgcatcttaaaacgacgcagcaatgtatttgcgcaaaacggcaaaatcgactgg
gcgcatgcggaaacgttggcgtttgccacgattttgcaagacggcgtgccgatccgcctc
accggccaagattcgcagcgcggcacgtttgcccaacgccatttagtgctgcacgacgtg
aaaactggaaaagagtatgttccgcttcatcatatcagcggtgcaaaagcttcgtttgtc
gtttacaacagcccattgactgaagcggccgtgctcggttatgaatacggatacaacgtg
tacgcaccggaaacacttgtgctttgggaagcgcagttcggcgattttgcgaatatggcg
caagtgatgtttgaccagtttatctcgtccggccgggcgaaatggggacaaaaatctggg
ctcgttatgctcttgccgcacggttatgaagggcaagggccggaacattccagcggccgt
atcgagcggtttttacagttggcggcagaaaacaactggacggtcgccaacttatcgacg
gcggcgcagtatttccatattttgcgccggcaagcggcgttgctgaaaaaagaagaagtg
cgcccgctcgtcctaatgacaccgaaaagcttgctccgtcatccgcttgcatcatccgaa
gctgaagcgcttgttcaaggtgcattctcaccggtgctcgaacagccaggattgggcgtt
gacgccagcaaggtcgagcggatcgtgtttggtactggcaaactgatgattgatttagcg
gaacaaatcggcaaaatggatgggcttgattggctgcacgtcgtccgtgtcgaagagctg
tatccgtttccagaagaggccgtgcaagctattatcgcccgctatccgaatgtaaaagag
cttgtttgggtacaagaggaaccgaaaaacatgggcgcttggatgtatatggaaccgcgc
ctgcgagccatcgctccagagggcgtcgatgtcagctatatcgggcgacgtcggcgagcg
agcccggcagagggcgatccggtcgtccatcggaaagaacaggagcgcattatccgctgt
gcattaacgaaacatgaatga

DBGET integrated database retrieval system