KEGG   Geobacillus thermodenitrificans: GTNG_1271Help
Entry
GTNG_1271         CDS       T00496                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gtn  Geobacillus thermodenitrificans
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gtn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GTNG_1271
Enzymes [BR:gtn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GTNG_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1342326..1343789
Genome map
AA seq 487 aa AA seqDB search
MTAGTERIYLNYINGKWTPSSTNQIEASINPANIRDIVGYVQQSNIEDLNAAVEAARRAQ
AAWRKLSGPKRGEYLFRTADILEQRLDEIAETMTREMGKTLPEAKGEVQRGVNILRYYAG
EGMRHIGEVIPSTNSEALMFTTRVPLGVVGVITPWNFPVAIPIWKIAPALIYGNTVVFKP
AQETAVTAAKVVECFDQAGVPAGVLNFVAGKGSVIGNAIAEHPHIHAITFTGSNEVGKTI
AQKAVARGAKYQLEMGGKNPVIVLEDADLDRAVEATISGGLRSTGQKCTATSRIFVQSSI
YEPFKEQLLAKIKQLKIGNGLEEGVWMGPCASQKQLETVLYYIEKGIEEGATLLYGGRRL
DGGELGNGFYVEPTVFENVSPNMTIAREEIFGPVLALIKVDTFEEAVALANDTSFGLSAS
IFTQNIAKMLTFIQEIEAGLVRINEESAGVELQAPFGGMKQSSSHSREQGRAAIEFFTAI
KTVFVKG
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgggaacggaaagaatctatttgaattatattaacggcaaatggactccttct
tccacaaatcaaattgaagcgagcatcaacccagccaatattcgcgatattgtcggctac
gttcagcagtccaatatcgaggacctgaacgctgcggtggaagcagcgagacgagcccaa
gcggcgtggcggaagttgtccggcccaaaacgcggggagtatttgttccgcacggctgac
attcttgaacaacgacttgatgagattgcggaaacgatgacaagggaaatgggaaaaacg
ctcccggaagcgaaaggagaagtgcagcggggagtgaacattttgcgctattatgctggg
gaagggatgcggcacattggtgaggtcattccatccactaacagcgaagcactcatgttt
acgacgcgtgtgccgctcggagtggttggggtgatcacaccgtggaactttccagtcgcc
attccgatttggaaaatcgcccctgccctcatttatggcaatacggttgtatttaaaccg
gcgcaagaaacggctgtcaccgcggcgaaggtggtcgagtgctttgatcaggcaggggtg
ccagccggcgtgttgaatttcgtggccggcaaagggtcggtcatcggcaacgccattgct
gagcatccgcatattcacgcgatcacgttcactggctctaacgaagtgggcaaaacgatc
gcccaaaaggccgtagcgagaggggcaaagtatcagttggaaatgggaggcaaaaacccg
gttatcgtgcttgaggatgctgaccttgaccgcgcagtcgaagcgacgattagcggagga
ctgcgttcgacgggacaaaaatgtacagcgacaagccgtatcttcgttcagagctccata
tatgaaccgtttaaagaacaactattagcgaagatcaaacagctgaaaatcggcaacgga
ctggaagaaggcgtgtggatggggccatgcgccagccaaaagcaattggagacggttctt
tattatatcgaaaaagggatcgaagagggagcgacattgctttatggcggccgccgattg
gacggcggggagttgggcaacggattttatgtggagccgacggtgtttgagaacgtatct
ccgaacatgacgatcgcccgcgaggaaattttcgggccggtgcttgctttgatcaaagtg
gatacgtttgaagaagcggtagccttagcaaatgatacgtcatttggtctcagcgcctca
atttttacccaaaatattgcgaagatgttaacgttcattcaagagattgaggccgggctc
gtgcggattaacgaagaaagcgccggcgtcgaacttcaggcgccatttggcggcatgaag
caatccagttcccattcacgggaacaaggacgggcggccattgaatttttcactgccatc
aaaaccgtctttgtcaaagggtaa

DBGET integrated database retrieval system