KEGG   Geobacillus thermodenitrificans: GTNG_2863Help
Entry
GTNG_2863         CDS       T00496                                 

Definition
(GenBank) Transglutaminase
  KO
K00686  
protein-glutamine gamma-glutamyltransferase [EC:2.3.2.13]
Organism
gtn  Geobacillus thermodenitrificans
Brite
Enzymes [BR:gtn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     GTNG_2863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2973449..2974267
Genome map
AA seq 272 aa AA seqDB search
MIRILALPSGLSPSYSSSLSKNEQAILNALISSPVLYTYPNEQQLRFEIALRANIVQAAV
DLAKSRARFAIFRFSRCNSEFWERDERGGFQLRPGIPPSEAIKDIFVNSERYAFECATAI
VIVFYKAVLDTIDVSAFNRLFADLLLYDWHTDRDLGIHTKKGEHFLPGDCLYFKNPEFDP
TTPQWQGENTIYLGNGLFYGHGIGIHPKEVIIDALNRKRKPGATKSAYLLPQITQVNFTY
LSQFARPLNEFRLPLRPSFIIGTLGSATFLYR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgatccgcattttagctttaccgtccggtttgagcccgtcttactcgtcttccctttcg
aaaaacgagcaggcgatcctaaacgctcttatttcttcgcccgtgctgtacacatatcca
aatgaacaacagctgcgatttgaaattgcgctgcgtgctaacatcgtccaagctgcagtc
gacttagcaaagagccgggcgcggtttgccatttttcgtttttcacgctgcaacagcgag
ttttgggagcgggacgagcgaggtggttttcagctgcgaccgggcatccctccttcagag
gccatcaaagacattttcgttaacagtgaacgatacgcctttgaatgtgcaactgccatc
gtcatcgtcttttacaaagccgtgctcgatacgattgacgtatcagcgtttaatcgcctg
ttcgccgatctactcctgtatgactggcatactgaccgcgatcttggcatccatacaaaa
aagggagaacactttctccctggggactgtctttattttaaaaacccggagttcgatccg
acgacgccgcaatggcagggggaaaatacgatttacttgggcaacggcttgttttacggg
catggcatcggcattcacccaaaagaggtcattatcgatgcactcaatcggaagcgaaaa
ccgggagcgacgaaatccgcctatcttctcccccaaattacgcaagtcaacttcacgtat
ttgtcccaattcgcccgcccgttgaacgaattccgcttgccgctccgcccatcgtttatc
atcggaacgttagggtccgctactttcttgtatcgttag

DBGET integrated database retrieval system