KEGG   Gloeophyllum trabeum: GLOTRDRAFT_105231Help
Entry
GLOTRDRAFT_105231 CDS       T03130                                 

Definition
(RefSeq) glutathione S-transferase
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
gtr  Gloeophyllum trabeum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:gtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GLOTRDRAFT_105231
Enzymes [BR:gtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GLOTRDRAFT_105231
Transporters [BR:gtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   GLOTRDRAFT_105231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 226 aa AA seqDB search
MSHGKQFTLYTHKGGPNGWKAALLLSELGLSYESIYLDFERGEQKTSPHVDLNPNGRIPT
IVDHGNNDFVLWESNAILLYLAERYDPDHTLSASTDADKYKQLQWLFFQASGQGPYFGQL
GWFSWYHHEKVPSAIERYAAEAKRVLGVLDGELAKREWLVGDKYTIADLSFIPWTVTGAT
GLIPGYDVSAEAPHVDKWLQRMLARPAVRAVYKEKDTIRAASASAQ
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacggcaagcaattcaccctctacacgcacaagggcggaccgaatgggtggaaa
gccgccctcctcctttccgagctcgggctctcctacgagtctatttaccttgacttcgag
cgcggcgagcagaagacttcgccgcatgtggacctgaacccgaatgggcggataccgact
atcgtggaccatgggaacaatgacttcgtcctgtgggagtcgaacgcgatcttgctctac
cttgccgagcggtacgaccctgaccacacgctcagcgcgagcaccgacgcggacaagtac
aaacagctccaatggctcttcttccaagcctcgggccagggcccctacttcggccagctg
gggtggttcagctggtatcatcacgaaaaggtgccctcggccatcgagcggtacgcagcc
gaggccaagcgcgtgctgggcgtcctggacggggagctcgccaagcgagaatggctcgtc
ggggataaatacaccattgccgacttgtccttcatcccctggacggtgaccggcgccacc
ggcctcatcccggggtacgacgtcagcgcggaagcgccgcatgtcgacaagtggctgcag
cgcatgctcgccaggccggcggtacgagcggtgtacaaggagaaggacacgatcagggcc
gcgagcgcctcagcacagtaa

DBGET integrated database retrieval system