KEGG   Gloeophyllum trabeum: GLOTRDRAFT_121909Help
Entry
GLOTRDRAFT_121909 CDS       T03130                                 

Definition
(RefSeq) alpha-amylase
Organism
gtr  Gloeophyllum trabeum
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 569 aa AA seqDB search
MKMRIPTILGVVLGLAVRGHATPTGNKTVIVQMFEWNWDSLAAECTNFLGPAGYGFVQAS
PAQEHITGSQWWTDYQPVSYTLTSKRGNRQQYQNMVTTCHAAGVRVIADTIFNHMSGSDS
GTGTAGTSFTHYNYPGTYEYQDFHHDCGEADGNIDNYDNRTEVQVCQLDGLADLDTESED
VRSTLAAYGNDLIGLGVDGLRLDAAKHIAATSLANITSRLTGSPYITSETIWGSGEPIQP
SEYVGIGDAQEFRYTTALKNAFTGGGISSLEDLDDQGWVASNKANVFVANHDTERNGNSL
NYNSGNNAYVLATIFSLAHPYGTPTVLSSYSFSTTDDGSPNSGAGTCSGTGGANGWLCQH
RWIAFSGMTGFRNNVGSAALTNWVSPGSNQIAFGRGSAGFVVINNQASSWTGTFATSLPA
GTYCDVVHGNSSGGVCSASAITVASDGTFSATVNPYDALAIHTGSKGTGSSVTTVAVTFD
ETATTTYGENIFVTGSISQLGSWSTTNAIALSSANYPTWSVTLNLPAGTTFQYKYIRKET
DGSVVWESDPNRSASTGSSGSLTLSDTWR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaggataccgacgatactcggtgtcgtcctcggacttgccgttcggggtcat
gcgacgcccactggtaataaaactgtcattgttcagatgttcgaatggaactgggacagt
ctcgcggcggagtgcacgaacttcctaggacccgccggttatggcttcgtccaagcgagc
cccgcacaggagcacatcaccgggagtcagtggtggaccgactaccagcccgtctcgtac
accctcaccagcaagcgcgggaacaggcagcagtaccagaacatggtcactacgtgccat
gccgcgggcgtgcgcgtcatagccgacaccatattcaaccacatgtccggctcggactct
ggcaccggaaccgctggcaccagtttcacacattacaactaccccgggacatacgagtac
caggacttccaccacgactgcggtgaggcggacgggaatatcgacaactacgataaccgt
accgaggtgcaggtgtgccagcttgacggtctagccgatctagatacggaatccgaggac
gtgcgcagcacgctcgccgcgtacgggaacgacctcatcggtctcggcgtcgacgggctg
cggctcgacgctgctaaacacattgctgccacctccctcgccaacatcaccagccggctc
accgggtcgccctacatcacctccgagaccatctggggatcgggcgagcccatccagccg
agcgagtatgtcggtattggcgatgcgcaggagttccgctacactaccgcgctgaagaac
gcgttcacgggcggcggaatttctagcttggaagacctcgacgaccagggatgggtcgcg
tccaacaaggcgaacgtgttcgtcgcgaaccacgacacagagcgcaatggaaactcgttg
aattacaactcggggaacaacgcttacgtcctcgctactattttctcgctggcgcacccg
tacggcacgccgaccgttctctcgagctactctttctccaccacggacgacggctccccc
aacagcggcgcggggacgtgctccggtactggcggcgcgaacggctggctctgccaacac
cgctggatcgccttctccggcatgactgggttcaggaacaacgtcggctctgcggcgctc
acgaactgggtgtcgcctggctcgaaccagattgcttttggcagaggctcggcaggcttc
gtggtcattaataaccaggcgtcgagctggacgggcaccttcgccacttctttgcccgcg
gggacgtactgcgacgtcgtgcacgggaactcgtcgggcggggtgtgctcggcctctgct
attaccgtcgcgtcggacggcacgttctccgcgacggtgaacccgtacgacgcgctggcg
atacataccggctcgaaaggcacggggtcgagtgttacgactgtggcagttacgtttgac
gaaacggcgacgacgacctacggagagaacatcttcgtcaccgggagcatctcgcagctg
ggctcgtggagcactacgaacgcgatcgcgctcagctcggcgaactaccccacctggtcg
gtaacgctcaacttgcccgcgggcaccactttccagtacaagtatatccgcaaggagacc
gacggaagtgttgtgtgggagtcggacccgaacaggagcgcgagcacgggttcctcgggg
agtttgacgttgagcgatacgtggagatag

DBGET integrated database retrieval system