KEGG   Gloeophyllum trabeum: GLOTRDRAFT_63876Help
Entry
GLOTRDRAFT_63876  CDS       T03130                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
gtr  Gloeophyllum trabeum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gtr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GLOTRDRAFT_63876
Enzymes [BR:gtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GLOTRDRAFT_63876
Glycosyltransferases [BR:gtr01003]
 Polysaccharide
  Storage polysaccharide
   GLOTRDRAFT_63876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 735 aa AA seqDB search
MSEPIKRDIRNPILFECAWEVANKVGGIYTVIKTKVPVTVSEFGDRYCLIGPLSYKTAPM
EVEAEEPSDPDLAASLDAMRAKGVKCLYGRWLIEGAPHVLLFDTGSQYSRLDEWKGDLWN
LAGIPTPPNDHETNETVVFGYLVAWFLGEYVARQLHTAVIAHFHEWQAGLAIPLCRKRHI
DVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNLHQTAKQKIHDFIRGHFYGHY
DFDLDNTLYMFTAGRYEYRNKGVDMFIESLARLNYRLQKANSKMTVVAFIIMPAATSSYT
IEALKGQAVTKQLRDTVTEIQNRIGMRLFEHAMRSNGEHGIMPTPDDFLSEEDKVLLKRR
IFALKRNSLPPITTHNMVDDANDPILNQIRRVQLFNHSHDRVKIIFHPDFLNSNNPILGL
DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQDLIERPEDEGCY
IIDRRMQSVEDSVNSLTTCMFQFCNKTKRQRINQRNRVERLSPLLDWKNLGMEYSKARQL
ALRRAYPDAFYGNDEEEFDFGAGIDRMMPSVPPSPRFRMSGMATPGDIGTLTEEMERLKT
SDYRGFNWPSQQEDEEEGYPFPLVMKVRSRASSVVSGASTPGGGTFRSLTENDLRKADAA
LSNVGDAPVNGVNGK
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagcccatcaaacgcgacattcgcaaccccatcctcttcgagtgcgcctgggag
gtcgccaacaaagtcggcggaatctacaccgtcatcaagacgaaggtccccgtcaccgtc
tcagagttcggcgacaggtattgccttatcggccctctcagctacaagacggcacccatg
gaagtcgaggcggaggagccctcagaccccgatctagcagcgtccctggacgcgatgcgc
gctaagggtgtcaaatgcttgtatgggcgatggttgattgaaggcgctccgcatgtcctg
ctatttgataccggcagtcagtactcacggttggatgagtggaagggcgacctctggaat
ctcgctggtatccctacccctccaaacgaccacgagacgaacgagacagtagttttcggg
tacctggttgcatggttcctcggcgagtacgttgctcgccaacttcataccgcggtcatc
gcgcacttccacgaatggcaggctggtctcgcaatcccattgtgccggaaacgacacatc
gacgtgacgactgtattcacaacccacgccaccctcctcggacggtatctgtgtgctggc
tccgtggacttctacaacaacctccagtactttgatgtcgaccacgaagctggcaagcgc
ggtatctaccaccgttattgcatagaacgctcctccgcccactgtgccgatgttttcacc
accgtctctcacatcaccgcctatgaatccgagcatctgctcaaacgcaaacctgacggc
gtcctgccgaacggcctgaacgtcgtcaagttccaggctatgcacgagttccaaaatcta
catcaaaccgcaaaacaaaagattcacgacttcatccgcggacatttctacggccactat
gactttgacctcgataacacgctctacatgttcaccgccggtcggtatgagtatcgaaac
aagggtgtcgatatgtttattgagtcattagcacgtctgaattatcgcctgcaaaaggcg
aactccaagatgacggttgtcgcatttatcatcatgcctgcagccacttcctcgtataca
atcgaagccttgaagggtcaagccgtcacaaagcaactgcgtgatactgtcacggagatc
caaaatcgtatcgggatgcgactattcgagcatgccatgcggtccaacggggaacacggt
attatgcccacgccagacgacttcctttcagaagaagacaaagtcctcctgaaacgccgg
atctttgcactcaagcgcaactcgctcccgccgattacgacgcacaacatggtcgacgac
gccaatgaccctatcctgaaccagatccggcgagtgcagctgttcaatcactcgcacgac
cgcgtgaagatcatcttccaccccgattttctgaattcgaataaccccattctgggtctc
gactatgaggagttcgtccgtggttgccatttgggcgtgttcccgagttattatgagcca
tggggatacactcctgcggaatgtacagtcatgggtataccctcgatcacgaccaacctc
tctggtttcggctgcttcatgcaagacctgatcgaacgtcccgaagacgagggctgctac
atcatcgacaggcgcatgcagtccgtcgaggactccgtcaactcgcttacgacgtgcatg
ttccagttctgcaacaagacgaagcgccagcggatcaaccagcggaaccgcgttgagcgc
ctgagcccgctgctcgactggaagaacctcggcatggagtactctaaggcgcgccagctt
gcgctgcgccgcgcgtaccccgacgcgttctacggcaacgacgaggaggagttcgacttc
ggtgcgggcattgacaggatgatgccgtcggtgccgccgagcccgcggttcaggatgtcg
ggtatggcgacacctggtgacattgggacgttgaccgaggagatggagcgattgaagact
agtgattaccgagggttcaactggccttctcaacaagaagacgaggaggaaggttatcct
ttccctctcgttatgaaggtcagatctcgcgccagctctgttgtgtcgggcgcaagcact
cccggcggaggtactttcaggagtctcacggagaatgacctgcgcaaggcggatgcggct
ttgagcaacgttggagatgctcctgttaacggcgtgaacgggaaatag

DBGET integrated database retrieval system