KEGG   Guillardia theta: GUITHDRAFT_91782Help
Entry
GUITHDRAFT_91782  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
gtt  Guillardia theta
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    GUITHDRAFT_91782
Enzymes [BR:gtt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GUITHDRAFT_91782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 229 aa AA seqDB search
MFRQGNKLSTSISRLSTLASRAAGVRAKSTLPSLPYDFGALEPVVNSEIMTLHHGKHHAT
YVNNLNAALEKMSDAMAKQDYATMIALQGAIQFNGGGHLNHSIFWQNLCPVKDVVAPSEA
NPELAKAIEGQWGSLDNFKTEFNTKTAAIQGSGWGWLGYNKQSKKLEIATCANQDPLVMK
GLVPLLGIDVWEHAYYLQYKNARPEYLKQIWQVVNWKDVAARYEAAKKA
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggcaaggaaacaaactcagcacaagcatctcccgcttgtcgactctcgcttcg
cgagcagcaggcgtcagggccaagtcaaccctcccatctttgccatacgatttcggtgcc
ctcgagccagtcgtcaactctgagatcatgacgctgcaccatggaaagcaccatgctaca
tacgtcaacaacctcaacgccgccttggagaaaatgtcggatgccatggccaagcaggac
tatgctaccatgattgcgttgcaaggagccatccagttcaatggaggtggtcacctcaac
cactccatcttctggcagaacttgtgtccggtcaaggacgtcgtcgctccctctgaggcc
aatcccgagttggcaaaggccatcgagggccagtggggctccctcgacaactttaagaca
gagttcaataccaagacagcggccattcaaggatccggctggggttggctgggatacaac
aagcagtccaagaagctcgagatcgccacgtgcgcgaaccaggaccctctggtcatgaag
ggactggttcccctcctcggtatcgacgtgtgggagcacgcgtattacttgcagtacaag
aacgcaagacctgagtacttgaagcagatctggcaggtggtgaactggaaggatgtagct
gcccgctatgaagcggccaagaaggcttag

DBGET integrated database retrieval system