KEGG   Guillardia theta: GUITHDRAFT_93507Help
Entry
GUITHDRAFT_93507  CDS       T02925                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gtt  Guillardia theta
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gtt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GUITHDRAFT_93507
   00020 Citrate cycle (TCA cycle)
    GUITHDRAFT_93507
   00620 Pyruvate metabolism
    GUITHDRAFT_93507
Enzymes [BR:gtt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GUITHDRAFT_93507
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 492 aa AA seqDB search
MPALSSTMKEGKIVQWTKSVGDKIEAGDIIMVVESDKADMDVEAFEEGYLAKILVSDGQS
AAVGSPVAIIVQDKCFQVSPSSCRDDIGKVSAADAPAASAPAAPAAAAAPAAAPAAAAVP
VAAPAPAAAASRAAGDRVVASPLAKSLAAERGINLADIVGTGPGGRITSMDVENFKGGSK
KKEDKASAPSGPTIDRTGGGVIPPGAIIASPQAKKAAKQSGFDLKKLAGKGTGPFGRITE
EDVLLAAGKAPAAPPAAPVKSSRKVPELPDGPVAMTGMQVAVANNMDATLNVPIFRVSRS
ITTDKFDELYAALKPKGVTVSALLSLAVARVLEKHPIMNARYDAASKSIVYRKDINIANA
VAIDGGLITPVLKNANMMDIETLSGQWKELVGKAKSGKLRPDEFQSGTFTISNLGMFGVS
QFGAILPPGQGTILAVGGAKEVVVMKNGAPSSVKQMEVTVTCDHRHIYGADAALFLKSLA
EMLEEHPLDIIL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctctcctccaccatgaaggagggaaagatcgtccagtggaccaagtccgtc
ggcgacaagatcgaggccggtgacatcatcatggtggtggaatcggacaaggcagacatg
gacgttgaggcgtttgaggagggatacttggccaagattctcgtttctgatggacagtca
gcagccgttggctcccctgttgccatcatcgtccaggacaagtgttttcaagtctcaccc
tcttcctgcagggacgacatcggcaaggtctctgctgctgacgctcccgctgccagcgct
ccagctgcccctgccgcggctgctgccccagctgctgctccagctgctgctgcagttccc
gtcgccgcacctgctcctgctgctgctgccagcagagctgctggagatcgtgtcgttgcc
tccccacttgctaagtctcttgcggctgagcgcggcatcaacctcgccgacatcgtgggc
acaggacccggaggacgcatcacgtccatggacgttgagaacttcaagggaggatccaag
aagaaggaggacaaggccagcgctcccagcggccccaccatcgacaggacaggaggagga
gtcattcctccaggcgccatcatcgccagcccgcaagccaagaaggcagccaagcagagc
ggtttcgacctcaagaagctcgcgggtaagggcaccggccccttcggtcgcatcaccgag
gaggacgtcctgctcgcggccggcaaggccccagctgcccctcctgctgctcctgtcaag
tcctcccgcaaggtccctgagctccccgacgggcctgtcgccatgacgggcatgcaagta
gcggtggcgaacaacatggacgctactctcaacgtccccatcttccgcgtgtcgaggagc
atcacgaccgacaagttcgacgagctctacgcggccctcaagcccaagggcgtcaccgtc
tctgccctcctctccctcgccgtcgcccgcgtgctcgagaagcatcccatcatgaacgcg
cgctacgacgccgcgagcaagtccatcgtctaccgcaaggacatcaacatcgccaacgcc
gtcgccatcgacggagggctcatcacccccgtgctcaagaacgccaacatgatggacatc
gagacgctgagcgggcagtggaaggagctggtgggcaaggccaagtcaggcaagctgaga
cccgacgagttccagtccggcaccttcaccatctccaacctcggcatgttcggcgtgagc
cagtttggcgccatccttcctccgggccagggaaccatccttgctgtcggaggagcgaag
gaggttgtggtgatgaagaatggcgcgccgagcagcgtcaagcagatggaggtgacagtc
acgtgcgatcatcggcacatctacggagccgacgctgctctcttcctcaagagcctcgcg
gagatgctcgaagagcacccgctcgacatcatcctgtaa

DBGET integrated database retrieval system