KEGG   Geobacter uraniireducens: Gura_4193Help
Entry
Gura_4193         CDS       T00521                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
gur  Geobacter uraniireducens
Pathway
gur00500  Starch and sucrose metabolism
gur01100  Metabolic pathways
gur01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gur00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Gura_4193
Enzymes [BR:gur01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Gura_4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417
Motif
Other DBs
NCBI-ProteinID: ABQ28336
UniProt: A5G968
LinkDB All DBs
Position
4855636..4858200
Genome map
AA seq 854 aa AA seqDB search
MNFSKILHRFTVTPSLPRELAGLQRIAYNLWWSWEPDAIELFTRLDPELWRETRHNPVEM
LGILQQTTLEGLKSDEGFISHLAMVDDKLTEYLTAKTWFDKLHKGEKNLKVAYFSMEFGL
HESLPIYSGGLGILAGDHLKSASDLGLPLVGVGLLYRQGYFRQYLNIEGWQQEFYPENDF
YNLPLHLERSADGAPLSFELDLAGNRVKAHIWRAQVGRIPLFLLDTNLEENSPEDRNITT
RLYGGDQDMRIRQEILLAIGGVRALHLMGIDPNVCHMNEGHAAFLALERTSILMEDRKLK
FSEAREAVKAGTVFTTHTPVEAGIDHFPSDLIEKYMGRYYRSLGLSREEFLGLGRQNPKN
PHETFCMAVLALKLTGHANGVSQLHGEVSRKMWKNIWPDLPEEHLPLTSITNGVHNKSWL
SREMARLLIRYLGTRWLEDPTDAGVWRRVSRIPDGELWRTHKHGREHLVDYARKRLKEQL
CQVGATAKEIAVADEVLDPDILTIGFARRFATYKRGTLLLHDTERLARIVNDSLRPVQIV
FAGKAHPADHQGKELIRQIVRLSHQERFRHRIVFLEDYDMSVARHLVQGVDVWLNTPLRP
LEASGTSGMKVAFNGGLNMSVLDGWWCEGYRGNNGWAIGRGEVYDDLDYQNEVESRAIYD
LLEKEIVPLFYDRGSDGIPRGWVTCVKASLQSLCPTFSTDRMVQQYAENFYLPAYEQWQK
LNRKESLLARDLAQWKEKIQRLWHQVRIDEVEAELTQEIMAGTKIPVTARIFLGEIPLQE
IAADVYFGVLDSRGAIVGGEIVPLEPVSEIDDGSHSFRGELDCRFCGRHGFMLRVMPRHH
ELGTVYEPKLVLWG
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgaatttcagcaagattctccacaggtttactgttaccccttccctgccaagggaattg
gcggggctgcaacgcattgcctataacctctggtggagctgggaaccggacgccatcgag
cttttcacgaggctcgaccccgagttgtggcgggaaacccgccataatcccgtggagatg
ctcggcatccttcagcagaccacccttgaagggttgaagtccgatgaaggtttcatctcc
cacctggccatggttgacgacaagctcacggaatatctcacggccaagacctggttcgat
aagctgcacaagggggaaaaaaatctcaaggttgcctatttctccatggaattcggcctc
cacgagtcgctccccatctattccggggggctcggcatcctcgccggcgaccatctcaaa
tcggccagcgacctgggactgccgctggtcggcgtcggactcttgtaccgccagggatat
tttcgtcaatacctgaacatcgaaggatggcagcaggaattctacccggaaaacgacttc
tacaacctgccgctgcatctggaacgcagtgccgacggcgcccccctttcctttgaactg
gacctggccgggaacagggtgaaggcacatatctggagggcgcaggtgggtcgcatcccc
ctcttcctcctggacacgaacctggaagagaactcccccgaagaccggaacataacgacc
cgcctctacggcggagatcaggacatgcgcatcaggcaggagatactcctcgccatcggc
ggcgtcagggctcttcacctcatggggatcgatccaaatgtctgccacatgaacgaaggt
cacgccgcttttctcgccctggagaggaccagtatcctcatggaagatcgtaagctgaaa
ttcagcgaagcgcgcgaggcggtaaaggcggggacggtctttaccacccacaccccggtc
gaagccggcatcgaccatttcccgtccgacctgatcgagaagtacatggggcgctactac
cgcagcctggggctttcccgcgaagaattcctcggccttgggcgtcagaacccgaaaaac
ccccacgaaaccttctgcatggcggtcctcgccctgaagctcacagggcatgccaacggc
gtcagccagctccacggcgaggtttcacggaaaatgtggaaaaacatctggcccgatctc
cccgaggaacacctgccgctcacctccatcaccaacggcgtccacaacaagtcctggctt
tcccgtgagatggcaaggctcctcatccgttacctggggacccgctggctggaagacccg
accgatgccggtgtctggcggagggtttcgcggattcccgacggagagctgtggcgcacc
cataaacacggcagggagcacctcgtggattacgcgcggaagaggctcaaggagcagctc
tgccaggtaggagccacggccaaggagattgcggtggcagacgaagtcctcgaccccgac
atcctgaccatcggttttgcccgccgctttgccacatacaagcggggcaccctgctattg
catgacacggagcggcttgcccggatcgttaatgattcgctcaggcccgtgcagatcgtt
tttgccggcaaggcccaccctgccgaccaccaggggaaggagctgatcaggcagattgtc
cgactctcccatcaggaacggttccgccaccgcatcgttttcctggaagactacgacatg
tcggttgcccgacacctggtgcagggagtcgacgtctggctcaacacccccctgcgcccc
ctggaagccagcgggaccagcggcatgaaggtggccttcaacggcggcctcaacatgagc
gtgctcgacggctggtggtgtgaaggataccgggggaacaacggctgggccatcggcagg
ggggaggtctatgacgacctggactaccagaacgaggtggaaagcagggccatctacgat
ctgctggaaaaagagatcgtgccgcttttttacgaccgcggcagtgacggaataccgcgc
ggatgggtcacctgcgtgaaggcgtcgctgcaatcgctctgtccgacattcagtaccgac
agaatggtgcagcaatacgcggagaacttctatctccccgcttatgaacagtggcagaag
ctcaaccgtaaagaatcgctgctggcaagggacctggcgcaatggaaggaaaaaatccag
cggctctggcaccaggtaaggattgacgaggtggaggcagaactgacccaggaaataatg
gccggaacgaagatccccgtcacggccagaatctttctgggcgaaatcccgctgcaggaa
attgccgcagatgtctatttcggggtgctcgattcccgcggcgccattgtcggcggcgag
atcgtccccctcgaacctgtttccgagattgacgacggaagccattccttcagaggcgag
ctggattgcaggttttgcggcaggcacggcttcatgctgcgggtcatgcccaggcaccat
gagcttggcaccgtttatgagccgaagctcgttctctggggttag

DBGET integrated database retrieval system