KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0607Help
Entry
HMPREF0424_0607   CDS       T01146                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
gva00010  Glycolysis / Gluconeogenesis
gva00230  Purine metabolism
gva00620  Pyruvate metabolism
gva01100  Metabolic pathways
gva01110  Biosynthesis of secondary metabolites
gva01120  Microbial metabolism in diverse environments
gva01130  Biosynthesis of antibiotics
gva01200  Carbon metabolism
gva01230  Biosynthesis of amino acids
Module
gva_M00002  Glycolysis, core module involving three-carbon compounds
gva_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gva_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0607 (pyk)
   00620 Pyruvate metabolism
    HMPREF0424_0607 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0424_0607 (pyk)
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HMPREF0424_0607 (pyk)
Membrane trafficking [BR:gva04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    HMPREF0424_0607 (pyk)
Exosome [BR:gva04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0424_0607 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ADB14409
UniProt: D2RAK8
LinkDB All DBs
Position
665414..666853
Genome map
AA seq 479 aa AA seqDB search
MRKAKIVDTIGPATESLEGITKLVEAGMDVARLNRSHGTPEDHLRVYNNVRAASKSTGRN
VAALVDLQGPKIRCGWFKKNAEGEDKVYLEEGQEFIITTDDVEGDEHRTSTTFKGLPGDC
HAGDPILIDDGKVRLEVTKVEGNDVHTKVIVAGPVSSHKGINLPGVAVSLPALTEKDEAD
LRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIVAKIEKPQAVENLEEIVKTFD
GIMVARGDMAVEMPLEEVPLVTKRCIELSRRYAKPVIVATEVLGTMVNSPVPTRAEASDC
ANAVLDGADATMTSNETAVGKYPDVTVKTMSRISQYATEHGYDRIPAVELDMSSTGAVSS
AAVDLADKLNAKAIVAYTQTGRTVHRISRERPTAPIFGLTNNEHTYRWLALSWGTEGFLI
DEDYHDMNRHDLMIFTDKVLREAGKVSDGDQIVILSTAQGERQAGRTDSIYVHTVGACD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagccaaaatcgttgatactattggtccagctaccgaatccttggaaggtatt
accaagcttgttgaagccggtatggatgttgctcgtttgaaccgttctcacggcactcct
gaagatcatttgcgcgtttacaacaacgttcgtgcagcttccaagtccactggccgcaat
gttgctgctcttgttgatttgcaaggtccaaagattcgctgcggttggttcaagaagaac
gctgaaggcgaagataaggtttatttggaagaaggtcaggagttcatcatcactactgat
gatgttgaaggtgacgagcaccgcacttctacaacttttaagggcttgccaggagattgc
cacgcaggcgacccaatccttatcgatgacggtaaggttcgtcttgaggtaaccaaggta
gaaggcaacgacgttcacactaaggttattgttgctggtccagtttccagccacaagggc
attaacctcccaggtgttgcagtttctcttccagctttgactgaaaaggatgaggctgat
cttcgttgggctattcgcaccggcgctgacattattgctatgtccttcgtgcgtttcgct
accgatattgatcgcgctcacgaaatcatggacgaagaaggtcgtcgtattccaatcgtc
gccaagattgaaaagccacaggctgttgaaaacttggaagagattgttaagaccttcgat
ggcattatggttgctcgtggtgatatggctgttgaaatgcctctcgaagaggttccactg
gtcaccaagcgttgcatcgagctttctcgtcgctatgcaaagccagttatcgttgctact
gaagttcttggcacaatggttaactctccagttccaactcgtgcagaagcttctgactgc
gctaacgctgttctcgacggtgctgacgcaacaatgacttctaacgaaactgctgttggt
aagtacccagatgttaccgtaaagaccatgtcccgtatttctcagtacgcaactgagcac
ggctatgatcgcattcctgctgttgagcttgatatgtctagcaccggtgctgtttcttct
gcagctgttgatttggcagataagcttaatgctaaggctattgttgcttacactcagact
ggtcgcacagttcatcgtatttctcgtgaacgtccaaccgctccaatctttggcttgact
aacaatgagcacacttatcgttggttggctttgagctggggcactgaaggcttcttgatt
gatgaagattaccatgacatgaatcgtcacgatttgatgatcttcaccgacaaggttctt
cgcgaagccggtaaggtttccgatggtgatcagattgttatcttgagcactgctcagggt
gaacgccaggctggtcgtactgactccatctacgttcacaccgttggtgcttgcgactaa

DBGET integrated database retrieval system