KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0607Help
Entry
HMPREF0424_0607   CDS       T01146                                 

Gene name
pyk
Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0424_0607 (pyk)
   01230 Biosynthesis of amino acids
    HMPREF0424_0607 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0607 (pyk)
   00620 Pyruvate metabolism
    HMPREF0424_0607 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0424_0607 (pyk)
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HMPREF0424_0607 (pyk)
Exosome [BR:gva04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0424_0607 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
665414..666853
Genome map
AA seq 479 aa AA seqDB search
MRKAKIVDTIGPATESLEGITKLVEAGMDVARLNRSHGTPEDHLRVYNNVRAASKSTGRN
VAALVDLQGPKIRCGWFKKNAEGEDKVYLEEGQEFIITTDDVEGDEHRTSTTFKGLPGDC
HAGDPILIDDGKVRLEVTKVEGNDVHTKVIVAGPVSSHKGINLPGVAVSLPALTEKDEAD
LRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIVAKIEKPQAVENLEEIVKTFD
GIMVARGDMAVEMPLEEVPLVTKRCIELSRRYAKPVIVATEVLGTMVNSPVPTRAEASDC
ANAVLDGADATMTSNETAVGKYPDVTVKTMSRISQYATEHGYDRIPAVELDMSSTGAVSS
AAVDLADKLNAKAIVAYTQTGRTVHRISRERPTAPIFGLTNNEHTYRWLALSWGTEGFLI
DEDYHDMNRHDLMIFTDKVLREAGKVSDGDQIVILSTAQGERQAGRTDSIYVHTVGACD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagccaaaatcgttgatactattggtccagctaccgaatccttggaaggtatt
accaagcttgttgaagccggtatggatgttgctcgtttgaaccgttctcacggcactcct
gaagatcatttgcgcgtttacaacaacgttcgtgcagcttccaagtccactggccgcaat
gttgctgctcttgttgatttgcaaggtccaaagattcgctgcggttggttcaagaagaac
gctgaaggcgaagataaggtttatttggaagaaggtcaggagttcatcatcactactgat
gatgttgaaggtgacgagcaccgcacttctacaacttttaagggcttgccaggagattgc
cacgcaggcgacccaatccttatcgatgacggtaaggttcgtcttgaggtaaccaaggta
gaaggcaacgacgttcacactaaggttattgttgctggtccagtttccagccacaagggc
attaacctcccaggtgttgcagtttctcttccagctttgactgaaaaggatgaggctgat
cttcgttgggctattcgcaccggcgctgacattattgctatgtccttcgtgcgtttcgct
accgatattgatcgcgctcacgaaatcatggacgaagaaggtcgtcgtattccaatcgtc
gccaagattgaaaagccacaggctgttgaaaacttggaagagattgttaagaccttcgat
ggcattatggttgctcgtggtgatatggctgttgaaatgcctctcgaagaggttccactg
gtcaccaagcgttgcatcgagctttctcgtcgctatgcaaagccagttatcgttgctact
gaagttcttggcacaatggttaactctccagttccaactcgtgcagaagcttctgactgc
gctaacgctgttctcgacggtgctgacgcaacaatgacttctaacgaaactgctgttggt
aagtacccagatgttaccgtaaagaccatgtcccgtatttctcagtacgcaactgagcac
ggctatgatcgcattcctgctgttgagcttgatatgtctagcaccggtgctgtttcttct
gcagctgttgatttggcagataagcttaatgctaaggctattgttgcttacactcagact
ggtcgcacagttcatcgtatttctcgtgaacgtccaaccgctccaatctttggcttgact
aacaatgagcacacttatcgttggttggctttgagctggggcactgaaggcttcttgatt
gatgaagattaccatgacatgaatcgtcacgatttgatgatcttcaccgacaaggttctt
cgcgaagccggtaaggtttccgatggtgatcagattgttatcttgagcactgctcagggt
gaacgccaggctggtcgtactgactccatctacgttcacaccgttggtgcttgcgactaa

DBGET integrated database retrieval system