KEGG   Gardnerella vaginalis 409-05: HMPREF0424_0607Help
Entry
HMPREF0424_0607   CDS       T01146                                 

Gene name
pyk
Definition
pyruvate kinase (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
gva  Gardnerella vaginalis 409-05
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0424_0607 (pyk)
   01230 Biosynthesis of amino acids
    HMPREF0424_0607 (pyk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0424_0607 (pyk)
   00620 Pyruvate metabolism
    HMPREF0424_0607 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    HMPREF0424_0607 (pyk)
Enzymes [BR:gva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     HMPREF0424_0607 (pyk)
Exosome [BR:gva04147]
 Exosomal proteins
  Proteins found in most exosomes
   HMPREF0424_0607 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
LinkDB All DBs
Position
665414..666853
Genome map
AA seq 479 aa AA seqDB search
MRKAKIVDTIGPATESLEGITKLVEAGMDVARLNRSHGTPEDHLRVYNNVRAASKSTGRN
VAALVDLQGPKIRCGWFKKNAEGEDKVYLEEGQEFIITTDDVEGDEHRTSTTFKGLPGDC
HAGDPILIDDGKVRLEVTKVEGNDVHTKVIVAGPVSSHKGINLPGVAVSLPALTEKDEAD
LRWAIRTGADIIAMSFVRFATDIDRAHEIMDEEGRRIPIVAKIEKPQAVENLEEIVKTFD
GIMVARGDMAVEMPLEEVPLVTKRCIELSRRYAKPVIVATEVLGTMVNSPVPTRAEASDC
ANAVLDGADATMTSNETAVGKYPDVTVKTMSRISQYATEHGYDRIPAVELDMSSTGAVSS
AAVDLADKLNAKAIVAYTQTGRTVHRISRERPTAPIFGLTNNEHTYRWLALSWGTEGFLI
DEDYHDMNRHDLMIFTDKVLREAGKVSDGDQIVILSTAQGERQAGRTDSIYVHTVGACD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagccaaaatcgttgatactattggtccagctaccgaatccttggaaggtatt
accaagcttgttgaagccggtatggatgttgctcgtttgaaccgttctcacggcactcct
gaagatcatttgcgcgtttacaacaacgttcgtgcagcttccaagtccactggccgcaat
gttgctgctcttgttgatttgcaaggtccaaagattcgctgcggttggttcaagaagaac
gctgaaggcgaagataaggtttatttggaagaaggtcaggagttcatcatcactactgat
gatgttgaaggtgacgagcaccgcacttctacaacttttaagggcttgccaggagattgc
cacgcaggcgacccaatccttatcgatgacggtaaggttcgtcttgaggtaaccaaggta
gaaggcaacgacgttcacactaaggttattgttgctggtccagtttccagccacaagggc
attaacctcccaggtgttgcagtttctcttccagctttgactgaaaaggatgaggctgat
cttcgttgggctattcgcaccggcgctgacattattgctatgtccttcgtgcgtttcgct
accgatattgatcgcgctcacgaaatcatggacgaagaaggtcgtcgtattccaatcgtc
gccaagattgaaaagccacaggctgttgaaaacttggaagagattgttaagaccttcgat
ggcattatggttgctcgtggtgatatggctgttgaaatgcctctcgaagaggttccactg
gtcaccaagcgttgcatcgagctttctcgtcgctatgcaaagccagttatcgttgctact
gaagttcttggcacaatggttaactctccagttccaactcgtgcagaagcttctgactgc
gctaacgctgttctcgacggtgctgacgcaacaatgacttctaacgaaactgctgttggt
aagtacccagatgttaccgtaaagaccatgtcccgtatttctcagtacgcaactgagcac
ggctatgatcgcattcctgctgttgagcttgatatgtctagcaccggtgctgtttcttct
gcagctgttgatttggcagataagcttaatgctaaggctattgttgcttacactcagact
ggtcgcacagttcatcgtatttctcgtgaacgtccaaccgctccaatctttggcttgact
aacaatgagcacacttatcgttggttggctttgagctggggcactgaaggcttcttgatt
gatgaagattaccatgacatgaatcgtcacgatttgatgatcttcaccgacaaggttctt
cgcgaagccggtaaggtttccgatggtgatcagattgttatcttgagcactgctcagggt
gaacgccaggctggtcgtactgactccatctacgttcacaccgttggtgcttgcgactaa

DBGET integrated database retrieval system