KEGG   Gardnerella vaginalis ATCC 14019: HMPREF0421_20243Help
Entry
HMPREF0421_20243  CDS       T01344                                 

Definition
(RefSeq) putative oligo-1,6-glucosidase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
gvg  Gardnerella vaginalis ATCC 14019
Pathway
gvg00500  Starch and sucrose metabolism
gvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gvg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HMPREF0421_20243
Enzymes [BR:gvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     HMPREF0421_20243
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     HMPREF0421_20243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF4434
Motif
Other DBs
NCBI-GeneID: 9903785
NCBI-ProteinID: YP_003985350
UniProt: E3D892
LinkDB All DBs
Position
284460..286166
Genome map
AA seq 568 aa AA seqDB search
MQNEHAQWLRDAVFYEIYPQSFYDSNGDGIGDIPGIIEKLDYVKSLGCNAIWLNPCYDSP
FKDAGYDVRDYKKVAARYGTNEDLQRLFSEAHNRGMHILLDLVPGHTSEEHEWFKQSSRA
QENEFSKRYIWTDSAFSGYSMPFIGGESERDATYILNFFKCQPALNYGFAQRDRAWQSAP
DSEEAAQTRAAMVDVMRFWLSLGADGFRVDMADSLVKNDDNNGEGSLGKDNTIHAWQEML
GAVKAEYPQAAFVSEWGRPRQALAAGFDMDFYLNWRWDGQPNGYARLARDVDNALDSNPE
HDHSYFNARGGGSICPFLDDYCPQYEATCNDGYFSFITCNHDTPRLAPRLDDRERRVAFG
MILTMPGVPFVYYGDEIGMKYRDIPTKEGGYARTGTRTPMQWDDSKNFGFSTAAKSKLYL
PVEARADGRTCANSRKQAVESGEIPTVLGQEQDGDSLLNWVRALIALRHECAALHADATW
RVLHAPVDGRSFAYERCAAESNVSDGESSTDRCIVVMNPGLNEETIALSALAGLTPEAIL
QPRLSVGAVACDSSALKLGAQSFAVFAL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacgaacatgcacaatggctgcgcgacgccgtgttctacgaaatctatccacaa
agcttctacgattcaaacggcgacggaataggcgatattccaggcataatcgaaaagctc
gactacgtaaaatcgcttggatgcaatgcgatctggctaaatccttgctacgattcgcca
tttaaagatgcgggctacgacgtgcgcgactacaaaaaagtggcagcgcgctacggcaca
aacgaggatttgcagcgtctttttagcgaagcacacaatcgcggaatgcacattttgcta
gaccttgttccaggacacacaagcgaagagcacgagtggtttaagcaaagctcgcgcgcg
caagaaaacgagtttagcaagcgatatatatggaccgacagcgcgtttagcggctattcc
atgccgtttattggcggcgaaagcgagcgagatgccacgtatattctgaacttcttcaaa
tgccagccagcgctaaattacggttttgcgcaaagggatcgcgcgtggcaatccgcgcca
gattctgaggaggcggcgcaaactcgcgctgcaatggttgatgttatgcgattctggctt
tcgcttggagcagacggcttccgcgtagacatggcggattcgcttgtaaaaaacgacgac
aacaatggcgaaggaagccttggcaaagacaacacgattcacgcatggcaagaaatgctg
ggtgctgtaaaggccgagtatccgcaggctgcgttcgtttcggagtggggcaggccgcgt
caggcgctggctgctggattcgacatggacttctatttgaattggcgctgggatgggcag
ccaaacggatatgcgcgcttagctagagatgtggataatgcgctagacagcaatcctgag
cacgaccacagctactttaatgcgcgtggtggcggcagcatttgcccatttttagacgat
tattgcccacaatacgaggctacttgtaacgacggctactttagctttataacgtgcaat
cacgatacgccgcgtttagctccgcgtcttgacgatcgtgagcgtcgcgtggctttcggc
atgattcttacaatgccaggcgtgccgtttgtgtattatggcgacgaaatcggcatgaaa
taccgcgatattcctacaaaagagggaggttatgcgcgcacgggtacgcgtacaccaatg
caatgggatgattccaagaattttggattctccacggccgcaaagtcgaagttgtatttg
cctgttgaagcgcgcgcggatggaaggacctgcgcaaattctcgcaaacaagcggtagaa
agtggcgaaattccaacggttttggggcaagagcaggatggtgattcgctgcttaactgg
gtgcgcgcgctgattgctttgcgccacgagtgcgcggcgctgcacgcggatgccacttgg
cgagtgttgcatgcgcctgtggatggtcgcagctttgcatacgagcgatgcgcggctgag
tcgaatgtgtcggatggcgaatcctctacagatagatgcattgtggttatgaatcctgga
ttaaacgaggagacgattgcgcttagcgcgcttgcggggcttacgccagaggcgattttg
cagccgcggctttcggttggagcggttgcttgcgattcttccgcgcttaaactaggcgcg
cagtccttcgccgtgtttgctttataa

DBGET integrated database retrieval system