KEGG   Gloeobacter violaceus: gll1948Help
Entry
gll1948           CDS       T00148                                 

Definition
(RefSeq) acyl-CoA synthetase
Organism
gvi  Gloeobacter violaceus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(2073530..2075320)
Genome map
AA seq 596 aa AA seqDB search
MTKSSGKPQMATATRTADNLVEALRRWASVRSARNAYTWEGESAGAVRLTFFEIDRLARA
IAARLQQSNLRGRRAVLLYPPGLEFVAAFMGCLYAGVTAVPAHSPRPRRPAPKLQAILAD
AGVTAVLTTAASLARSDQWTTQNPQLAGLQWLATDNLGTDLADTWQECTFSKDSLAFLQY
TSGSTGHPKGVMITHGNLLHNQRMVEGAFGHSDETIFAGWLPLFHDMGLIGNVLQPLHLG
IPCVLMSPVDFVQKPRRWLEAITRHRATTSGGPNFAYDLCVRKVSAEQREGLDLSSWRVA
FNGAEPVRAHTLQAFAAAFAGCGFRAKAFYPCYGLAEATLFVTGGLFQTPAVVRSVAAAA
LEQDRVVPAAEDDPGSRLLVGCGRPWLGQEVVIADPTNLTLCPPAQVGEIWVAGPSVARG
YWNRPAETAATFGARLAGTGAGPFLRTGDLGFIEGGELFVTGRLKDLIIIRGANHYPQDI
EASVENCHRALRPGCGAAFAVEFDGEERLVVVQELERQLPQALDFEEVLSSIRQAVAARH
GLHVDTAALIKTGSIPKTSSGKIQRRTCRSQFLDGTLPVLYAGGRSPMPPAGRPSV
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaagctcaggaaaaccacagatggcgacagcaacccggacggccgacaacctg
gtcgaggccctcaggcggtgggcttccgtgcgctccgcccggaacgcttacacctgggaa
ggggagagcgccggagctgtgcgactgacgttctttgaaatcgatcgcctggccagggcg
atcgccgccaggctgcagcagtcgaacttgcgcggacgacgggcggtgctgctctatccg
ccggggctggaatttgtggcggcctttatggggtgcctgtacgccggtgtaacggcagtt
ccggcccactccccgcggccgcgccgcccggcgccgaagctccaggccatcctggcggac
gctggggtgacggcggtgctgacgaccgcagcttccctggcccgcagcgatcagtggacc
acccagaatccccaactggccgggttgcaatggctggccaccgacaacctcggcaccgat
ctggccgacacctggcaggagtgcactttctccaaggacagcctcgcgtttttgcagtac
acctccggatcgacaggccatccgaagggggtaatgatcacccacggcaacttgctgcac
aaccagcggatggtcgaaggcgccttcgggcacagcgacgagacgatcttcgcgggctgg
ctgccgctctttcacgacatgggactaatcggcaacgtgctgcagccgctccacctgggt
atcccctgtgtcttgatgtcaccggtggattttgtgcagaagccgcgccgctggctcgaa
gcgatcacccgccaccgcgccaccaccagcggcgggccgaactttgcctacgacctgtgc
gtgcgcaaggtgtcggctgagcagcgcgaggggctcgatctgagcagttggcgcgtggcc
ttcaacggagcggagccggtgcgcgcccacaccctccaggcgtttgctgccgccttcgcc
gggtgtggatttcgggcgaaggcgttctatccttgctacggcctggcggaggccaccctg
tttgtgacaggtggtctttttcagacccccgccgtcgtgcgcagcgtcgccgccgccgcc
cttgagcaagacagggtcgtgcccgccgccgaggacgatcccggcagccgcctgctggtg
ggttgcggacgaccctggttggggcaggaggtggtgatcgccgatccgacgaatttgacg
ctctgcccccccgcgcaggtgggtgaaatctgggttgcagggccgagtgtcgcccggggc
tactggaaccggcccgccgaaaccgcagcgactttcggcgcccgtctggccggcacgggt
gccgggccattcctgcgcacgggcgatctcgggtttatcgagggcggggagttgttcgtc
accggccgcctcaaggacttgatcatcattcggggggcgaaccattacccccaggacatc
gaagcatcggtggaaaattgtcaccgggccttgcgcccgggctgtggggcggcttttgcc
gtcgaattcgacggcgaagaacggctggtggtcgtccaggaactcgaacgacagcttccc
caagcgctggatttcgaagaagtgctcagcagtatccgccaggcggtggcggcccgccac
gggctgcacgtcgatacggccgcgctgatcaaaaccggctccatccccaagacctccagc
ggcaaaatccagcgccgcacctgccgtagccagtttctcgacgggacgctgccggtgctc
tacgccgggggcagaagcccgatgccgcctgcggggcgcccgagtgtctga

DBGET integrated database retrieval system