KEGG   Gloeobacter violaceus: gll3495Help
Entry
gll3495           CDS       T00148                                 

Definition
(RefSeq) pyruvate kinase (EC:2.7.1.40)
  KO
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
gvi  Gloeobacter violaceus
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    gll3495
   01230 Biosynthesis of amino acids
    gll3495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    gll3495
   00620 Pyruvate metabolism
    gll3495
  Nucleotide metabolism
   00230 Purine metabolism
    gll3495
Enzymes [BR:gvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     gll3495
Exosome [BR:gvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   gll3495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(3704206..3706023)
Genome map
AA seq 605 aa AA seqDB search
MRVGADVFVLDANAQQTTAAPSERARFRRTKIVATIGPAVDDPQALRKLIQAGATTLRLN
FSHGNHEEHRRRIGLIRQISFELNQPVAILQDLQGPKIRLGKFADGPIVLKHGDPFILTS
HDVPANQHISPITYSRLIQEVPTGATILLDDGRVELVVERVDLEAQYLHCRTVGGGKLSN
SKGVNFPGVTLSVPAMTEKDREDLLFGLNQGVDWVALSFVRTPSDLLELKELIAQSGKRV
PVIAKIEKFEAFENLDAVIAACDGLMVARGDLGVEMPAEEVPLLQKRLIASANRAGKPVI
TATQMLDSMVSNSRPTRAEVSDVANAILDGTDAVMLSNETAVGEHPILAVETMARIADRI
ERSMPQRTWVDTGRSIPNAISQAVGSVAQQLGAQAILTLTKSGATARNVSKYRPRVPIIA
ITPSVSVARELQMVWGVYPLMVLDLPSTRQTFQAAISAAQDENLVLEGDLVVMTAGTIQG
LSGSTDLIKVEVVTAILGRGLGLGQNAVSGRARIVRHSDEAAALSPGDILIAPRTDANFI
EAIKLAGGIVTEESGLTSHAAIIGLRLGLPVLLGVKDCTTRIPDGVVLTLDPQKGVIFSG
AASAV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgggtgccgatgtgttcgttctagatgccaatgcccaacagacaactgccgcg
ccgagcgagcgggcgcgttttcgccgcaccaagattgtcgccaccatcggtcccgccgtc
gacgacccgcaggccctgcgcaagctcatccaggccggggcgacgaccctcagactcaat
ttttcccacggcaaccacgaggagcaccgccgccgcatcggcctcatccgccagatttcc
tttgaactcaatcagccggtggccatcctgcaggatctgcaaggtcccaagatccggttg
ggcaagttcgccgacggaccaatcgtcctcaagcacggcgacccgtttattctgaccagc
cacgacgtgcccgccaaccagcacatcagtccgatcacctactcgcgacttatccaggaa
gtgcccaccggcgccacgatcttgctggatgacgggcgggtggaactggtagtcgaacgg
gtggacctcgaagcccaatacctgcactgccggacggtgggggggggcaagctctccaac
agcaaaggcgtcaactttccgggtgtcaccctctcggtgccggcgatgaccgaaaaggac
cgcgaggatttgctcttcggtctcaatcagggcgtcgattgggtggccctcagtttcgtg
cgcaccccgagcgatttgctcgaactgaaggaactgattgcccaatcgggcaagcgggtg
ccggtgatcgccaagatcgaaaaattcgaggccttcgagaacctcgatgcggtgattgcc
gcctgcgacgggctgatggtggcccgtggcgatctgggcgtcgagatgcccgccgaggaa
gtgcccttgctccaaaagcggctgatcgcttcggccaatcgggccggcaagcctgtgatc
accgccacccagatgctcgattcgatggtgagcaacagccgcccgacccgcgccgaagtt
tccgatgtggccaacgccatcctggacggcaccgacgcggtgatgctctccaacgagacc
gccgtgggcgagcacccgatcttggcggtcgagacgatggcgcgcatcgccgatcgcatc
gagcgctcgatgccccagcgcacctgggtagacacgggccgctcgatcccgaacgccatc
tcccaggcagtgggaagcgtcgcccagcaattgggtgcccaggcgattctcaccctcacc
aagtccggcgccaccgcccgcaacgtcagcaagtaccggccgagggtgccgattatcgcg
attaccccgagcgtgtcggtggcgcgcgaactgcagatggtctggggggtctacccgctg
atggtcctggatctgccttcgacccgccagacctttcaagcggcgatcagcgccgcccag
gacgaaaacctcgtcctggaaggcgacctggtggtgatgaccgccggcaccatccagggg
ctctccggttcgacggacctgatcaaagtcgaggtggtgacggcgattctcggccgggga
ttgggcctgggtcagaacgccgtgagtggacgcgcccgcatcgtccgccacagcgacgaa
gcggcggccttgagtcccggggacatcctgattgccccgcgcaccgacgccaattttatc
gaagcgatcaagctcgcgggcggcatcgtcaccgaggagagcggcctcacctcccacgca
gcgattatcgggctgcgcctcggactgccggtactgctcggggtgaaagactgcaccacc
cgcatcccggacggggtggtgctcaccctcgatccgcaaaaaggggtcatcttctccggg
gcggcctccgccgtctag

DBGET integrated database retrieval system