KEGG   Gloeobacter violaceus: gvip280Help
Entry
gvip280           CDS       T00148                                 

Gene name
cmpB
Definition
(RefSeq) bicarbonate transport system permease
  KO
K11951  
bicarbonate transport system permease protein
Organism
gvi  Gloeobacter violaceus
Pathway
ABC transporters
Module
Bicarbonate transport system
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    gvip280 (cmpB)
Transporters [BR:gvi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Bicarbonate transporter [MD:M00321] [OT]
    gvip280 (cmpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2240369..2241205
Genome map
AA seq 278 aa AA seqDB search
MTTTLEGRRQSPVQQLLAALPDAGSLQKLAAPVVAIGVFLLLWQLLTLSPDATLPGPAKV
VSETWGLIVDPFFRGSGTNQGLFWQIAASLQRVALGFSLAAAVGIVVGILIGANALIYSA
LDPLFQVLRTIPPLAWLPISLAAIQQSEPAAIFVIFITAIWPIIINTAVGVQQIPQDYNN
VARVLQLSRPKYFFKVLLPAALPYIFTGLKIGVGLSWLAIVAAEMLIGGVGIGFFIWDAY
NSAKVSEIVLALVYVGLVGLLLDKLVGFIGKLVAPTER
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaccctcgaaggccgccgccaatcgccggtccaacaactgcttgccgcattg
cccgatgccgggagcctgcagaaactcgcagcgccggtggtggcgatcggtgtgttcctg
ctgctgtggcagctgttgactttgagtcccgacgccacgctgccgggacctgccaaggtg
gtctccgagacctggggactgatcgtggatccgtttttccggggttccggcaccaaccag
gggctcttctggcagatcgcagccagcctgcagcgggtggccctcggcttcagcctcgcc
gccgcagtcgggatcgtggtcggtatcttgatcggtgccaatgcgctgatctactcggcc
ctcgatccgctcttccaggtgctgcgcaccattccgcccctcgcctggctgcctatctca
cttgcggccatccagcagtccgaacctgcggcgatttttgtgattttcattaccgccatc
tggcccatcatcatcaacacggcggtaggcgtccagcagatcccccaggactacaacaac
gtcgcccgcgtcctgcagctgtcgcgcccgaagtacttcttcaaggtgctgctgccggcg
gccctgccgtatatcttcaccggcctcaagattggcgtcggcctctcgtggctggcgatc
gtggcggcggagatgctgattggcggcgtcggcatcggcttttttatctgggacgcctac
aacagcgccaaggtgagcgagatcgtgctcgccctggtctacgtcgggctggtgggcctg
ttgctcgacaagctggtgggcttcatcggcaagctcgttgctcccaccgagcgctga

DBGET integrated database retrieval system