KEGG   Gloeobacter violaceus: gvip297Help
Entry
gvip297           CDS       T00148                                 

Gene name
rbcS
Definition
(RefSeq) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
gvi  Gloeobacter violaceus
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:gvi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    gvip297 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    gvip297 (rbcS)
Enzymes [BR:gvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     gvip297 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2308900..2309220
Genome map
AA seq 106 aa AA seqDB search
MQTLPKKKFYETMSYLPPLTDAEIAKQIQYMLDKGYIPCVEFNETSEPTMVYWTMWKLPL
FSVRSPQEVLSEVNACRSSYPGCFIRVIGFDNIRQCQTMSFIVYKP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgcccaagaagaagttctacgagacgatgtcctatctgccgccgctcacc
gacgcggagatagccaagcaaatccagtacatgctcgacaaaggctatatcccctgcgtc
gaattcaacgagaccagcgagcccacgatggtctactggacgatgtggaaactgccgctg
ttttcggtacgctctccccaggaagtgctcagcgaagtgaacgcctgccgctcgtcctac
cccggctgctttatccgggtgatcggcttcgacaatatccgccagtgccagacgatgagc
ttcatcgtctacaagccctag

DBGET integrated database retrieval system