KEGG   Geobacillus sp. Y412MC52: GYMC52_0106Help
Entry
GYMC52_0106       CDS       T01399                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
gya  Geobacillus sp. Y412MC52
Brite
Translation factors [BR:gya03012]
 Eukaryotic Type
  Elongation factors
   GYMC52_0106
 Prokaryotic Type
   GYMC52_0106
Mitochondrial biogenesis [BR:gya03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    GYMC52_0106
Exosome [BR:gya04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GYMC52_0106
  Exosomal proteins of breast cancer cells
   GYMC52_0106
  Exosomal proteins of colorectal cancer cells
   GYMC52_0106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
128481..129668
Genome map
AA seq 395 aa AA seqDB search
MAKAKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKQGKAEAKAYDQIDAAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDEVPVIKGSALKALE
GDPQWEEKIIELMNAVDEYIPTPQREVDKPFMMPIEDVFSITGRGTVATGRVERGTLKVG
DPVEIIGLSDEPKTTTVTGVEMFRKLLDQAEAGDNIGALLRGVSRDEVERGQVLAKPGSI
TPHTKFKAQVYVLTKEEGGRHTPFFSNYRPQFYFRTTDVTGIITLPEGVEMVMPGDNVEM
TVELIAPIAIEEGTKFSIREGGRTVGAGSVSEIIE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagcgaaatttgagcgcacgaaaccgcacgtcaacattggcacgatcggccac
gttgaccacgggaaaacgacgttgacagctgcgatcacgacggttttggcgaaacaaggc
aaagccgaagcaaaagcgtacgaccaaatcgacgctgctccggaagagcgtgaacgcggg
attacgatttcgacggcgcacgtcgagtatgaaacagatgctcgccactatgcgcacgtt
gactgcccgggccacgctgactacgtcaaaaacatgatcacgggcgcggcgcaaatggac
ggcgcgatccttgttgtatcggcggctgacggtccgatgccgcaaacgcgcgaacacatt
cttctctcccgccaagtcggtgttccgtacatcgttgtattcttgaacaaatgcgacatg
gtggacgacgaagaattgcttgaacttgttgaaatggaagttcgcgatcttctctctgaa
tacgacttcccaggcgatgaagtgccggtcatcaaaggttcggcattaaaagcgcttgaa
ggcgacccgcaatgggaagaaaaaatcattgaactgatgaatgcggttgacgaatacatc
ccgacgccgcaacgtgaagtggacaaaccgttcatgatgccaatcgaggacgtcttctcg
atcacgggccgcggtacggttgcaacaggccgtgttgaacgcggtacgttgaaagttggc
gacccggttgaaatcatcggtttgtcggatgagccgaaaacgacgaccgttacgggtgta
gaaatgttccgcaaacttctcgatcaagcggaagccggcgacaacatcggtgcgcttctc
cgcggcgtatctcgtgatgaagtcgagcgcggccaagtattggcgaaacctggttcgatc
acgccgcacacgaaattcaaagcgcaagtatacgtcctgacgaaagaagaaggcggacgc
catactccgttcttctcgaactaccgtccgcaattctacttccgtacgacggacgtaacg
ggcattatcacgcttccggaaggcgtcgaaatggttatgcctggcgacaacgttgaaatg
acggtggaactgatcgccccgatcgcgatcgaagaaggtacgaaattctcgatccgcgaa
ggcggccgtacggtcggcgctggctctgtatcggaaatcatcgagtaa

DBGET integrated database retrieval system