KEGG   Geobacillus sp. Y412MC52: GYMC52_2774Help
Entry
GYMC52_2774       CDS       T01399                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
gya  Geobacillus sp. Y412MC52
Pathway
gya00010  Glycolysis / Gluconeogenesis
gya00230  Purine metabolism
gya00620  Pyruvate metabolism
gya01100  Metabolic pathways
gya01110  Biosynthesis of secondary metabolites
gya01120  Microbial metabolism in diverse environments
gya01130  Biosynthesis of antibiotics
gya01200  Carbon metabolism
gya01230  Biosynthesis of amino acids
Module
gya_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gya_M00002  Glycolysis, core module involving three-carbon compounds
gya_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
gya_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gya00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GYMC52_2774
   00620 Pyruvate metabolism
    GYMC52_2774
  Nucleotide metabolism
   00230 Purine metabolism
    GYMC52_2774
Enzymes [BR:gya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     GYMC52_2774
Membrane trafficking [BR:gya04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GYMC52_2774
Exosome [BR:gya04147]
 Exosomal proteins
  Proteins found in most exosomes
   GYMC52_2774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C PEP-utilizers HpcH_HpaI IF2_N
Motif
Other DBs
NCBI-ProteinID: ADU95151
JGI: GYMC52_2774
UniProt: A0A0E0TEU2
LinkDB All DBs
Position
complement(2830512..2832275)
Genome map
AA seq 587 aa AA seqDB search
MKRKTKIVCTIGPASESVDKLVQLIEAGMNVARLNFSHGDHEEHGRRIANIREAARRTGQ
TVAILLDTKGPEIRTHNMENGAIELKEGAKLIISMSEVLGTPEKISVTYPGLIDDVSVGS
KILLDDGLIGLEVNAVDKQAGEIVTTVLNSGVLKNKKGVNVPGVRVNLPGITEKDRADIL
FGIRQGIDFIAASFVRRASDVLEIRELLEANDALHIQIIAKIENEEGVANIDEILEAADG
LMVARGDLGVEIPAEEVPLIQKMLIKKCNMLGKPVITATQMLDSMQRNPRPTRAEASDVA
NAIFDGTDAVMLSGETAAGQYPVEAVRTMHQIALRTEQALEHRDILSQRTKESRTTITDA
IGQSVAHTALNLDVAAIVTPTVSGKTPQMVAKYRPKAPIIAVTSNEAVSRRLALIWGVYT
KEAPHVNTTDEMLDVAVDAAVRSGLVKHGDLVVITAGVPVGETGSTNLMKVHVISDLLAK
GQGIGRKSAFGKAVVAKTAEEACRKMVEGGILVTISTDADMMPALEKAAAIITEEGGLTS
HAAVVGLSLGIPVVVGVENATSLFKDGQEITVDGGFGAVYRGHASVL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggaaaacgaaaatcgtctgtacgatcgggccggcaagcgagagcgtagacaag
ctcgtgcaattgatcgaagcggggatgaacgtggcgcgcctcaacttttcgcacggagat
catgaggaacacgggcggcgcatcgccaacattcgcgaggcggcgaggcggacgggccaa
acggtcgccattttgctcgatacgaaaggtccggaaatccgcacgcacaatatggagaac
ggcgccatcgaactgaaggaaggggcaaagctcatcatttcgatgagcgaagtgctcggc
acgccggaaaaaatttctgtcacctatccggggctgatcgatgatgtgtccgttggttcg
aaaattttgctggacgacgggttgatcggccttgaagtcaacgcggtcgacaagcaagct
ggagaaattgtcacgaccgtcttaaacagcggtgtgctcaaaaacaaaaaaggggtcaat
gtccccggcgtgcgtgtcaatttgccgggcatcaccgagaaggaccgagccgatatttta
tttggcatccgccaaggcatcgacttcatcgccgcctcgtttgtgcgccgggcgtctgat
gtgctcgaaatccgcgagctgctcgaggcgaatgacgccttacatatccaaattatcgcg
aaaattgaaaatgaagaaggcgtcgccaacatcgatgaaattttggaagccgccgatggc
ctcatggtggcgcgcggcgaccttggcgttgagattccggctgaggaagtgcctctcatt
caaaaaatgctcattaaaaagtgcaacatgcttggcaagccggtcatcacagcgacgcaa
atgctcgactcgatgcagcgcaatccgcggccgacgcgggctgaggcgagcgatgtcgcc
aacgccatttttgacggcaccgacgccgtcatgctttccggagaaaccgcagccggccag
tatccggtcgaagcggtaaggacgatgcaccaaatcgcgctccgcaccgagcaggcgttg
gagcatcgcgacattttgtcccagcgcacgaaagagagccgaacgacgatcaccgatgcc
atcggccaatcggtcgcccacacggcgctcaatttggatgtcgcggcgatcgtgacgccg
acggtgagcggaaaaacgccgcagatggtggcgaaataccgcccgaaagccccgatcatc
gcggtgacatcaaacgaagcggtctcgcggcggctggcgctcatttggggcgtgtatacg
aaagaagcaccgcatgtcaatacaaccgatgaaatgctcgatgtggcggtcgacgcggca
gtgcgctccggcttggtgaagcacggcgacttggtcgtcatcacggccggcgtgccggtc
ggcgaaacgggatcgacgaacttaatgaaagtgcacgtcatcagcgacttgcttgccaaa
gggcaaggcatcggccgcaagtcggcattcggcaaggcggtcgtcgccaaaacggcggaa
gaggcgtgccgaaaaatggtagagggcggcattttagtcaccatcagcaccgatgccgat
atgatgccggctctcgaaaaagcagcggcgatcattactgaggaaggcgggttgacgagc
catgcggcggtcgtcggcttaagccttggcattccggtcgtcgtcggggtggaaaatgcc
acaagcttgtttaaagatgggcaagagatcacggtcgatggcggctttggcgccgtctac
cgcggccatgcgagcgtgttgtaa

DBGET integrated database retrieval system