KEGG   Geobacillus sp. Y412MC52: GYMC52_2884Help
Entry
GYMC52_2884       CDS       T01399                                 

Definition
(GenBank) Thermolysin
  KO
K01400  
bacillolysin [EC:3.4.24.28]
Organism
gya  Geobacillus sp. Y412MC52
Brite
Enzymes [BR:gya01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GYMC52_2884
Peptidases [BR:gya01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GYMC52_2884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2943463..2945103)
Genome map
AA seq 546 aa AA seqDB search
MNKRAMLGAIGLAFGLMAWPLGASAKERSMVWNEQWKTPSFVSGPLLKGEDAPEELVYRY
LDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPVYGAVLVAHVNDGELSS
LSGTLIPNLDKRTLKTEAAISVQQAEMIAKQDVADAVTKERPAAEEGKPTRLVIYPDGET
PRLAYEVNVRFLTPVPGNWIYMIDAADGKVLNKWNQMDEAKPGGGQSVAGASTVGVGRGV
LGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLPGSLWADGDNQFFASYDAAA
VDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQTF
LPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGE
DIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVH
YGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAF
NAVGVY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgcttggcgcgattgggttggcgtttggattgatggcttggccg
ctcggggcttcagcgaaggaaagatcaatggtgtggaacgaacagtggaagacgccatcg
ttcgtttctggtccgctgttaaaaggcgaggatgctccggaagaattggtttaccgttat
cttgatcaagagaagaatacgttccagcttggtggacaagcccgcgaacggctgagcttg
attggcaaacaaacggatgaactcggccatacggtcatgcgttttgaacagcgctatcac
ggcatcccagtgtatggcgccgtgctcgttgcccatgtcaacgatggcgaattgtcctct
ttgtcgggtacgctcattccgaatttggacaaacgaacgttgaaaacagaagctgccatt
tccgttcaacaagcggaaatgatcgcgaaacaagatgtggctgatgcggtgacgaaagaa
cggccggcggccgaagagggaaaaccaacgcggcttgtcatctatccggatggggagacc
ccgcgcctcgcctatgaagtcaatgtccgctttttaacccctgtcccaggcaactggatc
tacatgatcgatgccgcggacggaaaagtgttgaacaaatggaaccaaatggacgaggcg
aagccgggcggcgggcagtcggtcgccggcgcgtcgacggtcggcgtgggccgcggtgtg
ttgggggatcagaaatatatcaatacgacgtattcctcgtattacggctactactatttg
caagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcaccgttttg
cccggcagcttgtgggccgatggcgacaaccaatttttcgccagctatgacgcggcggcc
gtggacgcccattattacgccggcgtcgtgtatgattactacaaaaatgtgcacggccgg
ctgagctatgacggcagcaacgccgccatccgttcgaccgtccattacggccgcggctac
aacaacgcgttttggaacggttcgcaaatggtgtacggcgatggcgacggacagacgttt
ttgccgttttccggcggcattgacgtcgttgggcatgagctgacccatgcggtgacggat
tatacggccgggcttgtttaccaaaacgaatccggcgccatcaatgaagcgatgtccgat
attttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggcgaa
gacatttacacgcctgggatcgccggcgatgcgctccgctcgatgtccgacccggcgaaa
tacggcgatccggatcattattccaaacggtacaccggaacgcaagacaacggcggcgtc
catacaaacagcggcatcatcaataaagcggcgtatttgctcagccaaggcggcgtccat
tacggcgtgagcgtcaccggcatcggccgcgacaaaatggggaaaattttctaccgggcg
cttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgcgtgcaa
gcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacaggcgttc
aatgcggttggagtgtattaa

DBGET integrated database retrieval system