KEGG   Geobacillus sp. Y412MC61: GYMC61_0670Help
Entry
GYMC61_0670       CDS       T01101                                 

Definition
(GenBank) Thermolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
gyc  Geobacillus sp. Y412MC61
Brite
Enzymes [BR:gyc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     GYMC61_0670
Peptidases [BR:gyc01002]
 Metallo Peptidases
  Family M4: thermolysin family
   GYMC61_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY
Motif
Other DBs
NCBI-ProteinID: ACX77346
JGI: GYMC61_0670
LinkDB All DBs
Position
658832..660472
Genome map
AA seq 546 aa AA seqDB search
MNKRAMLGAIGLAFGLMAWPLGASAKERSMVWNEQWKTPSFVSGPLLKGEDAPEELVYRY
LDQEKNTFQLGGQARERLSLIGKQTDELGHTVMRFEQRYHGIPVYGAVLVAHVNDGELSS
LSGTLIPNLDKRTLKTEAAISVQQAEMIAKQDVADAVTKERPAAEEGKPTRLVIYPDGET
PRLAYEVNVRFLTPVPGNWIYMIDAADGKVLNKWNQMDEAKPGGGQSVAGASTVGVGRGV
LGDQKYINTTYSSYYGYYYLQDNTRGSGIFTYDGRNRTVLPGSLWADGDNQFFASYDAAA
VDAHYYAGVVYDYYKNVHGRLSYDGSNAAIRSTVHYGRGYNNAFWNGSQMVYGDGDGQTF
LPFSGGIDVVGHELTHAVTDYTAGLVYQNESGAINEAMSDIFGTLVEFYANRNPDWEIGE
DIYTPGIAGDALRSMSDPAKYGDPDHYSKRYTGTQDNGGVHTNSGIINKAAYLLSQGGVH
YGVSVTGIGRDKMGKIFYRALVYYLTPTSNFSQLRAACVQAAADLYGSTSQEVNSVKQAF
NAVGVY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgggcgatgcttggcgcgattgggttggcgtttggattgatggcttggccg
ctcggggcttcagcgaaggaaagatcaatggtgtggaacgaacagtggaagacgccatcg
ttcgtttctggtccgctgttaaaaggcgaggatgctccggaagaattggtttaccgttat
cttgatcaagagaagaatacgttccagcttggtggacaagcccgcgaacggctgagcttg
attggcaaacaaacggatgaactcggccatacggtcatgcgttttgaacagcgctatcac
ggcatcccagtgtatggcgccgtgctcgttgcccatgtcaacgatggcgaattgtcctct
ttgtcgggtacgctcattccgaatttggacaaacgaacgttgaaaacagaagctgccatt
tccgttcaacaagcggaaatgatcgcgaaacaagatgtggctgatgcggtgacgaaagaa
cggccggcggccgaagagggaaaaccaacgcggcttgtcatctatccggatggggagacc
ccgcgcctcgcctatgaagtcaatgtccgctttttaacccctgtcccaggcaactggatc
tacatgatcgatgccgcggacggaaaagtgttgaacaaatggaaccaaatggacgaggcg
aagccgggcggcgggcagtcggtcgccggcgcgtcgacggtcggcgtgggccgcggtgtg
ttgggggatcagaaatatatcaatacgacgtattcctcgtattacggctactactatttg
caagacaatacgcgcggcagcggcatttttacgtatgacggacgaaaccgcaccgttttg
cccggcagcttgtgggccgatggcgacaaccaatttttcgccagctatgacgcggcggcc
gtggacgcccattattacgccggcgtcgtgtatgattactacaaaaatgtgcacggccgg
ctgagctatgacggcagcaacgccgccatccgttcgaccgtccattacggccgcggctac
aacaacgcgttttggaacggttcgcaaatggtgtacggcgatggcgacggacagacgttt
ttgccgttttccggcggcattgacgtcgttgggcatgagctgacccatgcggtgacggat
tatacggccgggcttgtttaccaaaacgaatccggcgccatcaatgaagcgatgtccgat
attttcggcacgctcgtggagttctacgccaaccgcaacccggactgggagatcggcgaa
gacatttacacgcctgggatcgccggcgatgcgctccgctcgatgtccgacccggcgaaa
tacggcgatccggatcattattccaaacggtacaccggaacgcaagacaacggcggcgtc
catacaaacagcggcatcatcaataaagcggcgtatttgctcagccaaggcggcgtccat
tacggcgtgagcgtcaccggcatcggccgcgacaaaatggggaaaattttctaccgggcg
cttgtctactatttgacgccgacgtcgaacttcagccagctgcgcgccgcctgcgtgcaa
gcggccgctgatttgtacgggtcgacaagccaagaagtcaactcggtgaaacaggcgttc
aatgcggttggagtgtattaa

DBGET integrated database retrieval system