KEGG   Paenibacillus sp. Y412MC10: GYMC10_2998Help
Entry
GYMC10_2998       CDS       T01100                                 

Definition
(GenBank) Ribulose-bisphosphate carboxylase
  KO
K01601  
ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GYMC10_2998
Enzymes [BR:gym01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     GYMC10_2998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3441849..3443120)
Genome map
AA seq 423 aa AA seqDB search
METNRVTATYLVETPLTLEQAAASIAGEQSTGTFTAVPGETEPLKERHGARIERITPLEQ
VAQPSLPGALAPPAAQGCYSRGEIVVSFPLHNFGPSIPNLMACVAGNLYELRELSGLRLV
DLELPEDFKTRYPGPRFGIEGTRRITGVRGRPIIGTIIKPSVGLGRAELEALVYDLAVSG
VDFIKDDELNANPPYLPLREKAETVMRAIGRAADKTGRKAMYACNITGDIEELQRNHEHV
VKAGGNCVMVSINSIGFAGLAYLNGFSEVPVHGHRNQWGMLTRHGQLGMDFRVYQKLCRL
AGADHLHVNGLGSKFYESDESVARSVEACLQPMWDGYSAMPVLSSGQWAGTAETTFERTR
SVDVMHLAGGGILAHPDGPAAGVESMKQGWEAAMRGIPAEEYAKERVELRRAFDKFKHKE
RAL
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaatcgggtaacggctacttatttggtggaaaccccgttgacgctggagcag
gcggccgcgtccatcgcgggggagcaatcgacgggcacgttcacggcggtgcccggcgag
acggagccgctcaaggagcggcacggcgccagaatcgaacgaatcacgccattggagcag
gttgcgcagccgtcgcttcccggagcgctcgctccgccggccgctcaaggatgctattcg
cgcggagagattgtcgtgtcgttcccgcttcataatttcgggccgtcgattccgaatctg
atggcctgcgtggccggcaatctgtacgagctccgcgagctgtcggggttgcgtctcgtc
gatctggagctgccggaggacttcaagacccgttatccgggtccgcgcttcggcatcgaa
gggacccggcgaataaccggagtccgcggccggccgatcatcggtacgatcattaagccg
agcgtgggtctcgggcgtgcggaattggaggcgctcgtatacgacctggccgtatcgggg
gttgatttcatcaaggacgacgagctgaacgcgaatccgccttatttgcccctgcgggaa
aaagcggagacggtgatgcgggccatcgggagagcggcggacaagacggggcgcaaggcg
atgtacgcctgcaatattacgggcgacatcgaagagctgcaacgaaaccacgagcatgtg
gtcaaggcgggcggcaattgcgtaatggtcagcatcaacagcatcggtttcgcgggactc
gcctatttgaacggcttcagcgaggttcccgtccacggtcaccggaatcagtgggggatg
ctgacgcggcacggacagctcgggatggatttccgggtctatcagaagctgtgcaggctt
gcgggggccgaccatctgcacgtgaacggtctgggcagcaagttctacgaaagcgacgaa
tccgtcgcgaggtccgtggaagcctgtctgcagcccatgtgggacggctattcggcgatg
ccggtactctcgtcggggcaatgggcggggacggcggagacgacgttcgaacggacgcga
tcggtagatgtcatgcatctcgccggcggaggcattcttgcccatccggacgggccggct
gccggcgttgaaagcatgaagcaaggctgggaggccgcgatgcgcggcattcccgccgaa
gaatacgcgaaggagcgggtcgagctgcggcgcgcgttcgacaagtttaagcacaaggaa
cgagcgctatga

DBGET integrated database retrieval system