KEGG   Paenibacillus sp. Y412MC10: GYMC10_3269Help
Entry
GYMC10_3269       CDS       T01100                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K22187  
alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
gym  Paenibacillus sp. Y412MC10
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:gym00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    GYMC10_3269
Enzymes [BR:gym01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GYMC10_3269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3769999..3771465)
Genome map
AA seq 488 aa AA seqDB search
MMAFQGEQVYRNYINGEWMKAASGENEPSINPANRNEVVGYVPVSGIEDLNRAVAAAKAA
GRAWRRLTGSERGNVLYKAANVLERRVDEVAEAMTREMGKTLAEAKGETMRGVAILRYYA
GEGMRKIGDVIPSTDSEALMFTTRVPLGVVGVIAPWNFPVAIPIWKTAPALIYGNTVVLK
PAQETAVTAAKLMECFEEAGIPAGVLNLVCGRGSVIGSALAEHPDVNGITFTGSNEVGKR
VGAAALGRGAKYQLEMGGKNPIIIAADADLDLAVEATISGGLKSTGQKCTATSRVIVERK
VYEAFKEKLLSQIREIRLGDGMSSESWMGPCANEGQLETVLNYIHKGQDEGAVLLTGGKR
ADGPGLEEGFYVQPTVFEGVEPHMSIAREEVFGPVLALIAVDSLEEAIETANDSDFGLSA
SIYTQNVGAMLSFIRDMDAGLVRINAETAGVELQAPFGGMKMSSSHSREQGQAAIEFFTS
IKTVFVKS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatggcatttcaaggagagcaagtatacaggaactatatcaacggagaatggatgaag
gcggcgtccggagaaaacgaacccagcatcaatccggcaaaccggaatgaggtagtcggg
tatgtaccggtttccggtatagaggatctgaaccgtgctgtcgcagcggccaaagcagca
ggccgagcctggcggcgattaaccggctcggaacgcggcaatgttctgtacaaggcggcg
aatgtgctggaacgccgggtcgacgaggtcgccgaggcgatgacgagggaaatgggcaaa
acgctcgcagaagctaagggagagacgatgcgcggcgtcgcgatccttaggtattacgct
ggcgaagggatgcgaaaaatcggcgatgtcattccttccacggacagcgaagcactgatg
tttacgacccgtgtaccgcttggcgtcgtgggcgtgattgccccatggaattttcccgta
gcgattccgatttggaagacggccccggctttgatatacggcaataccgttgtgttaaag
ccggcgcaggaaacggcggtcacggcagccaaactgatggaatgctttgaggaagcggga
attccggcaggcgttctcaatcttgtatgcggcagaggttcggtgatcggatctgcgctt
gccgagcatccggatgtcaacgggataacgtttacaggttccaacgaagtcggaaaacgg
gtcggcgccgccgctttggggcggggagccaagtatcagcttgaaatgggcggcaaaaat
ccgatcattatcgcggcagatgcggacctggacttggcagtcgaggccaccatcagcggc
ggcttgaaatccaccggccaaaaatgcaccgccaccagccgggtcattgttgagcggaaa
gtatatgaagcctttaaagaaaagctcctgtcgcaaattcgggagatccggttgggcgac
ggcatgtcttccgaaagctggatgggaccgtgcgcgaacgaaggacagctcgaaacggtg
ctgaactatattcataaagggcaggatgaaggtgccgtgctgctgaccggcggaaaaaga
gcggacggtccaggacttgaagagggattctatgtccagccaaccgtatttgagggtgtc
gaaccgcatatgtccatagcccgggaagaagtcttcggtcctgtgcttgcattgatcgcg
gtggattccctggaggaagccatagagacggccaatgacagcgactttggcttgagtgcc
tccatctatacgcaaaatgtcggggcaatgctgtcattcatccgggatatggatgccgga
ttggtcaggatcaatgcggaaacggccggtgtagagctgcaggcgccgttcggcgggatg
aagatgtcaagctcgcattccagggaacagggtcaagcagcgatcgagtttttcacttct
atcaaaacggtcttcgtgaagtcataa

DBGET integrated database retrieval system