KEGG   Halotalea alkalilenta: A5892_11380Help
Entry
A5892_11380       CDS       T04333                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
haa  Halotalea alkalilenta
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:haa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A5892_11380
  Energy metabolism
   00680 Methane metabolism
    A5892_11380
Enzymes [BR:haa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A5892_11380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2555051..2557747
Genome map
AA seq 898 aa AA seqDB search
MRHTLPVATEGNDLNESLRENVRILGDILGRTITSDLGEPFLERIERIRALAKQGRNDSS
DSSDSGESPKALIDYLGSLPDEDLLPVTRAFNQFLNFANIAEQHHRASVRRVEDYRPNLQ
PEDLGRLFERVIDDGVDAGTLRETLTSMRVELVLTAHPTEVVRRTLIQKYDMIDDCLAEL
EATRGYPERRERLLERLAELISQAWHTDEIRRVRPTPVDEARWGFAVIENSLWQALPEFY
RDLDQRLLAIGEQRLPLDASPLRFASWMGGDRDGNPNVTAKVTEEVLLLARWMAADLYLR
DLEALRVELSMWQASDELKAEVGDVDEPYRALIKQLIKRLQATREALRARLDGERSNTEV
ALIETGEQLLVPLKLCYRSLLECGMQSIANGALLDTLRRIACFGVTLTKLDIRQESERHT
QVMVELVEELFGEDYSTWDEARRQQFLVRELESKRPLLPRDWHGSDQVREVLDTFRVIAA
SRAEALGSYVISMAGQASDVLTVALLMKEAGGPRLPISPLFETLDDLDRSGPVIERLLDI
PVYRRLIGDRQEVMIGYSDSAKDAGQLAAAWAQYRAQEALVRICQRQGVALTLFHGRGGT
VGRGGGPVHAAILSQPPGSVSGSLRVTEQGEMIRFKFGQPDIASRNMEIYVGAVLEATLA
PPPAPRPEWREEMDRLAEIAHRVYVGVVRENADFVPYFRALTPEGALGRLPLGSRPAKRR
QEGGVETLRAIPWIFAWTQTRLMLPAWLGSDEAFAMRLADPEGRRRIEEMRRDWPFFGTY
LDLLEMLLAKSDASLTAYYEQRLVDAPELRVLGATLRERLGRLIDQLLEISGQRVLLEHS
PLIRQAIAVRNPYIDPLHGLQAELLRRSRDAEQSISPVLERALMVTMAGIAAGLRNTG
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcacaccctgcccgtcgccacagaaggcaatgacctcaacgaatcgttgcgagag
aacgtacgcattcttggcgatatcctggggcggaccatcacctcggatctcggcgagcct
ttcctcgagcgcatcgaacgcatccgcgctctggccaaacagggtcgcaacgacagcagt
gatagcagtgacagcggcgagagcccaaaggcgctgatcgactacttaggctcgctgccc
gacgaggacctgctgccggtcactcgcgccttcaaccagtttctcaacttcgccaacatc
gccgaacagcaccaccgtgccagcgtgcggcgggttgaggactatcggcccaacctgcaa
ccagaggacctgggacggcttttcgagcgggtcatcgacgacggcgtcgacgccggcacc
ctgcgcgagacgctcacgtccatgcgcgtcgagctggtgctcaccgctcatcccaccgaa
gtggtgcggcgcaccttgatccagaagtacgacatgatcgacgactgcctcgctgagctc
gaagccacccggggctacccggagcggcgcgagcggctgctcgagcgcttggccgagctg
atcagccaggcctggcacaccgacgagattcgccgggtgcgcccgactcccgtcgatgag
gcgcgctgggggttcgctgtgatcgagaactcgctgtggcaagcgctgcccgagttctat
cgtgatctcgaccagcgcttgctggcgatcggcgaacagcggctgccgctcgatgcatca
cccttgcgcttcgcctcctggatggggggagatcgtgacggcaaccccaatgtcaccgcg
aaagtcaccgaagaggtgctgctgctcgcccgctggatggcggcggatctctacctgcgc
gatctcgaggcgctgcgggtggagctctcgatgtggcaggccagcgacgagctcaaggcc
gaggtcggtgatgtcgacgaaccctatcgcgcgctgatcaagcagctgatcaagcggctg
caggctactcgcgaggcgctgcgtgcgcggctcgacggcgagcgctcgaataccgaggtg
gcgctgatcgagaccggtgaacagctgcttgtcccgctgaagctctgctatcgctcgctg
ctcgagtgcggcatgcagagcatcgccaacggtgcgctgctcgataccctgcgtcggatc
gcctgcttcggtgtgaccctgaccaagctcgatatccgccaggagtccgaacgccacacc
caggtgatggtggagctggtcgaggagctgttcggtgaagactactcgacctgggacgag
gcgcgtcggcagcagttcctggtccgcgagctggagtccaaacgtccgctgctgccgcgc
gactggcacggctcggatcaggttcgcgaggtgctcgataccttccgggtgatcgccgcg
tcgcgtgccgaagccttgggcagctacgtgatctcgatggcagggcaggcctcggacgtg
ctcaccgtggccttgctgatgaaggaggccggcggccccaggcttccgatctcgccgctg
ttcgaaaccctcgacgacctcgaccgctcgggcccggtgatcgagcggctgctcgatatt
ccggtctaccgccggctgatcggcgatcgccaggaggtgatgatcggctattccgattcg
gccaaggacgccgggcagctcgccgctgcctgggcgcagtatcgcgcccaggaggcgctg
gtgcggatctgccagcgccaaggggtggcgctgacgctgttccacggccgcggtggcacc
gttggccgcggcggcgggccggtgcacgcggcgatcctctcccagccgcccggttcggta
agtggcagtctcagggtcaccgagcaaggcgagatgatccgcttcaagttcggccagccc
gacatcgcctctcgcaacatggagatctacgtcggtgcggtgctcgaggccacgctcgca
ccgccgcctgcgccgcgaccggagtggcgcgaggagatggaccggctggccgagatcgcc
caccgggtctacgtcggcgtggtgcgtgagaatgccgatttcgttccttacttccgcgcg
ctgacgcccgagggcgcgttggggcggctgccgctcggctcacgtccggccaagcgccgc
caggaaggcggggttgagaccctgcgggcgattccatggatcttcgcctggacccagacc
cggctgatgctgccggcctggctcggcagtgacgaagccttcgccatgcgactcgccgat
cccgaagggcgtcgccggatcgaggagatgcgtcgcgactggccgttcttcggcacctat
ctcgacctgctcgagatgctgctggccaagtccgacgcctcgctcaccgcctactacgag
cagcggctggtcgatgcccctgagctgcgcgtgcttggcgctacgctgcgcgagcggttg
ggccggctgatcgaccaactgctcgagatcagcggccagcgcgtgttgctcgagcattcg
ccgttgatccgtcaggccatcgcggtacgcaatccctacatcgacccgctgcatggtctc
caggccgagctgctgcggcgctcgcgcgatgccgagcagagcatctccccggtgctcgag
cgcgcgctgatggtcaccatggccgggatcgccgcggggctgcgcaacactggctga

DBGET integrated database retrieval system