KEGG   Hipposideros armiger (great roundleaf bat): 109385863Help
Entry
109385863         CDS       T04661                                 

Gene name
TUFM
Definition
(RefSeq) Tu translation elongation factor, mitochondrial
  KO
K02358  elongation factor Tu
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
Translation factors [BR:hai03012]
 Eukaryotic Type
  Elongation factors
   109385863 (TUFM)
 Prokaryotic Type
   109385863 (TUFM)
Mitochondrial biogenesis [BR:hai03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    109385863 (TUFM)
Exosome [BR:hai04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109385863 (TUFM)
  Exosomal proteins of breast cancer cells
   109385863 (TUFM)
  Exosomal proteins of colorectal cancer cells
   109385863 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-GeneID: 109385863
NCBI-ProteinID: XP_019504060
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAAATLLRATPLFSGLGAGPTPLLQGLLRPLKVPALSLLCRGLAVEAKKTYVRDKPHVNV
GTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYSTAAR
HYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLAKQIGVEHVVVYV
NKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEQRDPELGLKSVQKLL
EAVDTYIPVPTRDLEKPFLLPVESVYSIPGRGTVVTGTLERGILKKGDECEFLGHNKNIR
TVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMAKPGSIQPHQKVEAQVYILS
KEEGGRHKPFVSHFMPVMFSLTWDMACRVILPPGKELAMPGEDLKLSLILRQPMILEKGQ
RFTLRDGNRTIGTGLVTDTPVMTEEDKNLKWS
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccaccctgctgcgcgcgacgcccctcttcagcggtctcggcgccggcccg
accccactgctgcagggcctgttgcggccgctgaaggtcccggccctgtccctcttgtgc
cgcggcctggccgtggaggctaagaagacctacgtgcgcgacaagccccacgtgaacgtg
ggtaccatcggccatgtggatcacggcaagaccacactgacagcggccatcacgaaaatt
ttagctgagggaggcggggccaagtttaagaagtacgaggagattgacaatgcccctgag
gagcgagcccgcggtatcaccatcaatgcggcccatgtggagtatagcactgctgcccgc
cactacgcccacacagattgcccgggtcatgcagattacgtgaagaatatgatcacaggt
actgcccccctcgatggctgcatcctggtggtggcagccaatgacggccccatgccccag
acccgagagcacttactactggccaaacagattggagtggagcatgtggtggtgtatgtg
aacaaggcagatgctgtccaggactctgagatggtggagttggtggagctggagatccgg
gagctgctcaccgagtttggctacaaaggggaggagaccccagtcatcgtgggctctgcc
ctctgtgccctggagcaacgcgaccctgagctaggcctgaagtctgtgcagaagctgctg
gaagctgtggacacctacatcccggtgcccacccgggacttggagaagcctttcctgctg
cctgtagagtcagtttactccattcccggccggggcacggtggtgacaggtacgctagaa
cgcggcattttgaagaagggagatgagtgtgagttcctgggacataacaagaacattcgc
acggtggtgacaggcattgagatgttccacaagagcctggagagggccgaggcaggtgat
aaccttggggccctggtccgaggcctgaagcgggaggacctgaggcgcggcctggtcatg
gccaagccagggtccatccagccccaccagaaggtggaggcacaggtttacatcctcagc
aaagaggaaggcggccgccataagcccttcgtgtcacacttcatgcccgtcatgttctcc
ctgacgtgggacatggcctgtcgcgtcatcctgcctccagggaaggagcttgccatgccc
ggggaggacctgaagctgagcctgatcttgcggcagccaatgatcttagaaaagggccag
cgtttcaccctgcgagatggcaaccggaccatcggcaccggccttgtcactgacacacca
gtcatgaccgaggaggacaagaacctcaagtggagctga

DBGET integrated database retrieval system