KEGG   Hipposideros armiger (great roundleaf bat): 109389302Help
Entry
109389302         CDS       T04661                                 

Gene name
KMT5B
Definition
(RefSeq) lysine methyltransferase 5B
  KO
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hai00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109389302 (KMT5B)
Enzymes [BR:hai01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109389302 (KMT5B)
Chromosome [BR:hai03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109389302 (KMT5B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 882 aa AA seqDB search
MKWLGESKNMVVNGRRNGGKLSNDHQQNQSKLQHTGKDTVKAGKNAVERRSSRCNGNSGF
EGQSRYVPSSGMSAKELCENDDLATSLVLDPYLGFQTHKMNTSAFPSRSSRHFSKSDSFP
HNNPVRFRPIKGRQEELKEVIERFKKDEHLEKAFKCLTSGEWARHYFLNKNKMQEKLFKE
HVFIYLRMFATDSGFEILPCNRYSSEQNGAKIVATKEWKRNDKIELLVGCIAELSEIEEN
MLLRHGENDFSVMYSTRKNCAQLWLGPAAFINHDCRPNCKFVSTGRDTACVKALRDIEPG
EEISCYYGDGFFGENNEFCECYTCERRGTGAFKSRVGLPAPAPVINSKYGLRETDKRLNR
LKKLGDSSKNSDSQSVSSNTDADTTQEKNNATSSRKSVGVKKTSKSRTLTRQSLSRIPAS
SNSTSSKLTHINNSRVPKKLKKPAKPLLSKIKLRNHCKRLEPKSASRKLEMGNLVLKEPK
VVLYKNLPIKKEKEPEGPVQAAVASGCLTRHAAREHKQNSGRGVPPQGEAAAGMYTTRRS
VRTKVNLKETSDIKLEPNTSDGYKNGLSEPCPDSGEQPTPVTEEEELAHESAQKEEAECP
KSDSSIAKKKARQGKLVKQLAKAEESTPLHDSPGQTGEVPDVTGSHPDPGEHSGTEGVPG
SYVDWAPSPVDGSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLRRR
HDSSSKTNDQENDGMNSSKISIKLSKDHENDNNLYVAKLNNGFNSGSGSSSTKLKIQLKR
DEESRGSYAEGLHENGVCCSDPLSLLESRMEVDDYSQYGEESTDDPSSSEGDGEEDDYDD
DFEDDFIPLPPAKRLRLIVGKDSIDIDISSRRREDQSLRLNA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggttgggagaatccaagaacatggtggtgaatggcaggagaaatggaggcaag
ttgtctaatgaccatcagcagaatcaatcaaaattacagcacacggggaaggacaccgtg
aaggcgggcaaaaacgcagtcgagaggaggtcaagccgatgtaatggtaattcaggattt
gaaggacagagtcgatatgtaccatcttctggaatgtctgccaaggagctctgtgaaaac
gatgacttagccaccagtttggttcttgatccctatttaggttttcaaacgcacaaaatg
aatactagcgcctttccttcgaggagctcaaggcatttttcaaaatctgacagttttcct
cacaacaaccctgtgagatttcgacctattaaaggaaggcaagaagaactaaaggaagtc
attgaacgttttaagaaagatgagcacttggaaaaagccttcaaatgtttgacttcaggc
gaatgggcacggcactatttcctgaacaaaaacaaaatgcaggaaaaattattcaaggaa
catgtgttcatttacttgcgaatgtttgcaactgacagtggattcgaaatattgccttgt
aatagatactcatcagaacaaaatggagccaaaatagttgcaacaaaagagtggaaacga
aatgacaaaatagaattactggtgggttgtattgccgaactttcagaaattgaggagaac
atgctacttagacatggagaaaacgacttcagtgtcatgtattccacaaggaaaaactgt
gctcagctctggcttggtcctgctgcatttataaaccatgattgcagacctaactgtaag
tttgtgtcaactggtcgcgatacagcatgtgtgaaggctctgagagatattgaacctgga
gaagaaatatcttgttactatggagatgggttttttggagagaataatgagttctgcgag
tgctacacgtgtgaaagacggggaactggtgcttttaaatccagagtgggactgcctgcg
cctgctcctgttatcaatagcaaatatggactcagagaaacagataaacgtttaaatagg
cttaaaaagttaggtgacagcagcaaaaattcagacagtcaatctgtcagctctaacact
gacgctgataccactcaggaaaaaaacaatgcaacttctagccgaaaatcagttggtgtg
aaaaagaccagcaagagcagaacattaactaggcaatctctgtcaagaattccagcttct
tccaactctacctcatctaagctaactcatataaataattccagggtaccaaagaaactg
aaaaagcctgcaaagcctttactctctaagataaaactaagaaatcactgcaaacggctg
gagccgaagagtgcttcgcgaaaactcgagatgggaaacttagtacttaaagagcctaaa
gtcgttctgtataaaaatttgcccattaaaaaagaaaaggagccggagggaccagtacag
gccgccgtggctagtgggtgcttaacgagacacgcagcgagagagcacaagcagaactcg
gggcgaggtgtgcccccacagggggaggctgccgccggcatgtacaccaccagacggtcc
gtgcggacgaaagtgaacttgaaggagacctctgacatcaagcttgaaccaaatacgtcg
gatggctataaaaacggcttgtcggaaccttgcccagacagtggcgagcagcctactcct
gtgacagaggaggaagaactagctcatgaaagtgcacaaaaggaggaagccgagtgccct
aagagtgacagcagcattgcaaaaaagaaggcacgacaaggaaaacttgtgaaacagttg
gcaaaagcagaggaatccactccgctgcatgatagccccgggcaaaccggtgaggtgccc
gatgtgacagggtcccaccctgacccgggcgagcacagtggcacggagggtgtgcccggg
agctacgtggactgggccccttcgcctgtcgatgggtcagtggtgacatcagacagcttc
aaaacaaaagacagcttcagaactgcaaaaagtaaaaagaagaggcgaatcacaaggtat
gatgcacagttaatcctggaaaataactctgggatccccaaattgactctccgtaggcgc
catgatagcagtagcaagacaaatgaccaagagaatgatggaatgaattcttcaaaaata
agcatcaagttaagtaaagaccatgaaaacgacaacaatctctatgtagcaaagcttaac
aatgggtttaactcaggatcaggcagtagctctacgaaactgaaaatccagctgaagcga
gacgaggagagcagggggtcgtatgcagaggggcttcatgaaaacggggtgtgctgcagt
gacccgctctctctcctggagtcgcgcatggaagtcgatgactatagtcagtatggggaa
gagagtaccgatgacccgtcctcttcggagggagacggggaggaggatgactatgatgat
gactttgaagatgattttattcctctccctccagctaagcgcctgaggctcatagtgggg
aaagactcgatagatattgacatttcttccaggagaagagaagatcagtctttgaggctt
aacgcataa

DBGET integrated database retrieval system