KEGG   Hipposideros armiger (great roundleaf bat): 109393695Help
Entry
109393695         CDS       T04661                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
hai  Hipposideros armiger (great roundleaf bat)
Brite
Enzymes [BR:hai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109393695 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 844 aa AA seqDB search
MGRLPQAAKLLLLLPPPPPALLLAPILEKKGREDLMDGPRSDMGRWGGNPWQPPATPSPE
PEPDRPSRRGGRSFWARCCACCSCRSGADDDGGPESHRDRGSGGRRSDSRGSDSRRPISR
GSGVNATGDGTIREGMLVVTGVDLLSSRSDQNRREHHTDEFEYDELILRRGQPFHMVLFL
SRPYESSDSVTLELHIGNNPEVGKGTHVIIPVGKGSSGGWKAQVTKSSGQNLNLRVHTSP
NAIIGKFQFTVRTHSKAGEFLLPFDPHNEIYILFNPWCSEDIVYVDHEDWRQEYVLNECG
RIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLD
DNGVLIGNWSGDYSQGTNPSAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGL
ATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFN
GWQVVDATPQETSSGIFCCGPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSF
KIVYVEEKAIGTLIITKAIGSNMREDVTHIYKHPEGSAAERKAVETATAHGSKPNVYATR
DSAEDVTVQVEAQDAVMGQDLTASVVLTNRGSSRRTVKLHLYLSVTFYTGVTGPVFKEDK
KEVVLAPGASDRVTMPVAYKEYKSHLVDQGAMLLNISGHVKENGQVLAKQHTFRLRTPDL
SLTLLGAAMVGQECEVQIVFKNPLPVILTNVVFRLEGSGLQRPKILNVGDIGGNETVTLR
QTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPASGDRGIFSDAGADSRSGETIPMAS
RGGA
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggggaggctccctcaggctgctaagctgctgctgctgctgccaccgccgccaccagca
ttactactggcacctattctggaaaagaaagggagagaggacctgatggatggtcctcgt
tcagacatgggccgctggggcgggaacccctggcagcctcctgccacaccttccccagag
ccggagccagacaggccgtctcgtcgtgggggccgttccttctgggctcgctgctgtgcc
tgctgctcctgccggagtggggcagatgatgacggggggcctgagtcccacagagaccga
ggctctgggggccgaagatcagactcccgtggctcagactcccgccggcctatctcgcgg
ggcagcggtgtgaatgcaactggagatggcaccatccgagagggcatgctggtggtgacc
ggcgtggatctgctgagttcacgctcagatcagaaccgccgagagcatcacacagatgag
ttcgagtatgatgagctgatcctgcgccgtgggcagcctttccacatggtcctcttcctg
tctcggccctatgagtcctccgatagtgtcaccctggaactgcacattggaaacaaccct
gaggtgggcaagggcacccatgtgatcatcccagtgggcaaggggagcagtggaggctgg
aaggcccaggtgaccaagtccagtgggcaaaatctgaacctacgggtccacacctccccc
aatgccatcatcggcaagtttcagttcacggtccgcacacactcaaaggctggcgagttc
ctgttgcccttcgatccccacaatgagatctacatcctcttcaatccctggtgctcagag
gacatcgtgtacgtggaccatgaggattggcggcaggagtacgtgctaaatgagtgtggg
agaatttactacgggactgaagcacagattggcgagcgaacctggaactacggccagttt
gaccacggggtgctggatgcttgcctgtacatcctggaccggcggggcatgccatatgga
ggccgtggggacccagtcagtgtctcccgggtcatctctgccatggtgaactccctggat
gacaatggggtcctgattgggaactggtctggcgattactcccaaggcaccaacccatca
gcatgggtgggcagcgtggagatcctactcagctacctacgcactggctattctgtcccc
tatggccagtgctgggtcttcgccggagtgaccaccacagtgctgcgctgcctgggcctg
gctacccgtactgtcaccaacttcaactcagcacatgacacagacacgtccctcaccatg
gacatctactttgatgagaacatgaagcctctggagcacctgaaccatgattccgtttgg
aacttccacgtgtggaacgactgttggatgaagaggccggatctgccctctggctttaat
gggtggcaggttgtggatgccacaccccaggagaccagcagtggcatcttctgctgtggc
ccctgctctgtggagtccatcaagaatggcctggtctacatgaagtatgacacacccttc
atttttgctgaggtgaacagtgacaaggtgtactggcagcggcaggatgatggcagcttc
aagattgtgtatgtggaggagaaggccattggcacactcatcatcacaaaggccattggc
tccaacatgcgggaggatgtcacccacatctataagcacccagaaggctcagcagcagaa
cgcaaggcagtagagacagcaacggcccacggcagcaaacccaatgtatacgccacccgg
gactccgctgaggatgtgacagtacaggtggaggcccaggacgcagtgatggggcaggac
ctgacagcctctgtcgtgctgaccaatcgcggcagcagccgccgcactgtgaagctgcac
ctctacctctcagtcaccttctacactggcgtcacagggcctgtcttcaaggaggacaag
aaggaagtggtgctagcgccaggggcctcggaccgcgtgaccatgcctgtggcctacaag
gaatacaagtcccacctcgtggaccagggggccatgctgctcaacatctcaggccacgtc
aaagagaatgggcaggtgctggccaagcagcacaccttccgtctgcgcaccccagacctc
tccctcacgctattgggagcagccatggttggccaggagtgcgaggtacagattgtcttc
aagaaccccctgcctgtcatcctcaccaacgtcgtcttccggctcgagggctccgggtta
cagagacccaagatcctcaacgttggggacattgggggcaacgagacagtgacattgcgc
cagacgttcgtgcctgtgcgaccaggcccccgccagctcatcgccagcttggacagtcca
cagctatcccaggtgcacggtgttatccaggtagacgtggccccagcctctggggacagg
ggcatcttctcagatgctggagctgacagtcgctcaggagagaccatccccatggcttct
cgaggtggggcttag

DBGET integrated database retrieval system