KEGG   Halomonas sp. KO116: KO116_00405Help
Entry
KO116_00405       CDS       T03800                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hak  Halomonas sp. KO116
Pathway
hak00010  Glycolysis / Gluconeogenesis
hak00053  Ascorbate and aldarate metabolism
hak00071  Fatty acid degradation
hak00280  Valine, leucine and isoleucine degradation
hak00310  Lysine degradation
hak00330  Arginine and proline metabolism
hak00340  Histidine metabolism
hak00380  Tryptophan metabolism
hak00410  beta-Alanine metabolism
hak00561  Glycerolipid metabolism
hak00620  Pyruvate metabolism
hak00625  Chloroalkane and chloroalkene degradation
hak00903  Limonene and pinene degradation
hak01100  Metabolic pathways
hak01110  Biosynthesis of secondary metabolites
hak01120  Microbial metabolism in diverse environments
hak01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hak00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KO116_00405
   00053 Ascorbate and aldarate metabolism
    KO116_00405
   00620 Pyruvate metabolism
    KO116_00405
  Lipid metabolism
   00071 Fatty acid degradation
    KO116_00405
   00561 Glycerolipid metabolism
    KO116_00405
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KO116_00405
   00310 Lysine degradation
    KO116_00405
   00330 Arginine and proline metabolism
    KO116_00405
   00340 Histidine metabolism
    KO116_00405
   00380 Tryptophan metabolism
    KO116_00405
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KO116_00405
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KO116_00405
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KO116_00405
Enzymes [BR:hak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     KO116_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487 OmdA
Motif
Other DBs
NCBI-ProteinID: AJY48913
UniProt: A0A0D5LZM7
LinkDB All DBs
Position
408266..409732
Genome map
AA seq 488 aa AA seqDB search
MSGTYSDFYLQLIGGKWREGSSERTTEVLNPYDNRVLLTTRLANRDDLDAAFTTAEQAQT
EWAATPPAERAELLQRVVAIFDARKEEIIDWLIRESGSTRLKANIEWGAARGISREAASM
PGRVHGMTMSSNVPGKENRIYRKPLGVVGVISPWNFPLHLSQRSIAPALALGNAVVVKPA
SDTPVTGGLLLAKIFEEAGLPAGLLSVVVGAGSEIGDAFVEHRVPRMISFTGSTQVGRGI
GRIASGGEHIKKVALELGGNSPFVVLDDADLDQAVNAAAMGKFLHQGQICMAVNRIIVDE
SVYDDFVERFVTKVKGLQVGDPNDMATVVGPVINVKQREGLEEKIATAKREGATVLVEGE
INGQLIPPHVFSDVTPDMEISREEIFGPLVGIQKARDEAHALELANGTEYGLSSSVFSGD
IERGMRFAQGIKAGMTHINDMPVNDEAHVPFGGEKNSGLGRFNGDWAIEEFTTDHWISVQ
QTPRRYPF
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcacttatagcgatttttatcttcagctaatcggtggtaaatggcgcgagggc
agtagcgagcgtaccaccgaagttctcaacccttacgataaccgcgtactgctgacgacg
cgcttagccaatcgcgatgatttggatgccgcattcacgacggcagaacaagcccaaacc
gagtgggcggcgacgccacctgctgagcgagctgagttattgcagcgtgtggtagcgatc
ttcgatgcgcgtaaagaagaaattattgactggttgattcgtgaatcaggcagcacacgt
ctaaaagcaaacattgagtggggggcggctcgcggtatctcccgagaagctgccagtatg
ccggggcgtgtccacggtatgacgatgtcctccaacgtgccaggtaaggaaaaccgtatc
taccgcaagcctcttggcgtggtgggggttatcagcccatggaattttccgttacatctt
tctcagcgttccatcgcccccgcgctggcgctgggcaatgcggtagtggttaagccagct
agcgatacgccggttactggcggactactgctagcgaagatcttcgaggaggctggtctg
cccgccggcctactcagtgtggtggtcggtgctggcagcgaaatcggggatgctttcgtc
gaacaccgcgtaccccgtatgatctctttcacgggctcgacccaggtaggccgcggtatc
gggcgaatcgccagcggcggtgaacatattaagaaggtggcgctggagcttggtggcaat
agccccttcgtagtgttggatgacgcagaccttgatcaggcagttaacgccgcggcgatg
ggtaaatttctccaccaaggacaaatctgcatggcggtcaaccgcatcatcgttgatgaa
agcgtctatgacgactttgtcgagcgctttgtcaccaaggtgaaaggactgcaagtgggt
gatcccaacgatatggctacggtcgttgggcctgttatcaacgtcaagcagcgtgaaggg
ctggaagagaagattgctactgccaagcgtgaaggcgctaccgttttggtagagggcgag
attaatggccagttgatcccaccgcatgtattcagtgatgtcaccccggatatggaaatc
agtcgtgaggagatcttcggtccgttggtcggtattcagaaagcccgggacgaggctcac
gcactagaactggctaatggcactgagtacggcctctccagcagcgttttcagtggtgat
atcgagcgcggaatgcgctttgcccagggcatcaaggcaggcatgactcatatcaacgat
atgccagttaacgatgaggctcatgtgcccttcggtggtgagaagaactcgggccttggt
cgtttcaatggtgattgggcaatcgaggagtttactaccgaccactggatcagcgtgcag
caaacgccgcgccgttatcctttttaa

DBGET integrated database retrieval system