KEGG   Halomonas sp. KO116: KO116_03399Help
Entry
KO116_03399       CDS       T03800                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
hak  Halomonas sp. KO116
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3688625..3698416)
Genome map
AA seq 3263 aa AA seqDB search
MNSHPSHNVVNHSFVEHLSRLAQERPSDRALIVVNAQGDTTLDYATLERRSRALASELQQ
RFPAGERALILLDNDEHYVVAFFACLYAGVIAVPVFPPESAKQQHLARLLAIAADSQAAC
VLTSTTIIDVVASASEGFGSAELIPVDAVDESRAEHWVEHHPKRGDIAFLQYTSGSTATP
KGVMVSHGNLMANERAIETGFSIGADDVFVSWLPLYHDMGLIGGLLQPIYRGIPAVLMSP
TFFLQRPVRWLEAISRHRGTISGGPDFAYRLCLERIRDEQLEALDLSSWRVAFSGAEPVR
HDTLTGFIERFRPAGFAADTAAPCYGLAEATLLVSCNSRGTGVVGTAFSQQSLAEGKAAS
AVEGNTLVGCGTPEPCHAIDIVDPEGLHSLPNGEVGEIWVNGPSVAHGYWQNPEATAKAF
VTRDGVSWQRTDDTDAQNHDARDDRWLRTGDLGFLHEGQLYIAGRIKDLIILRGHNVYPQ
DIESAIEAEVEAVRKGRVAAFAVTTPEGAEGIGVAAEVSRGIQKLVPAEKLVEALSETVG
SACHEPLSVVLLLNPGGLPKTSSGKLQRSACRQGWEAGSLDAYAIHAFGHFVSGGDAEDA
GGGESSQSTAESGSETEQTLAMLWRQALGNNKETPLGSNAHFFASGGNSLAAVRLAAAIS
DHWGVELSLHALFEQPRLSAMAKAIEACLAASSDQRVLVIPRLEDAQRQGDIPLSEGQRS
LWLTWQLDPQSAGYNMAGALHLKGVLDLSALNAALEALVQRHDILRTYYPLSEAGEPVQR
LAQDWSPELICNDIPGDTVVEQEQALHDALTQLARQPFDLEQAPPLNVVLYRLSTEHHVL
AVVQHHIAGDGWSVQVLIDDLCAFYESACTQRDVELAPLPIQFADYAVWQQRQQHSSERQ
GQLAHWCERLSGDHPPLALPLDRPRQAMSAPSEGHLRFTLPGELSEQLRSLARERNVSLY
AVILALLKQTLYRFSGETDIKVGAPIANRHKAELQGLIGYLINVVVLRTQIDHTGNFDRL
LDEVNATLIDAQLHQDVPFDQVVEALQLERQPGVHPLFQVKCTQQEMWQAERHVAGLAIQ
AEQVFTGIAHFDLSLDFCDEPEGITGLFAYSAELFDAATIERFCQAFRCLAEQVVADPQS
HTAMLALPEPISVLEGNQSEFLAQDIPTLLSKAVAANADELAINDGQYRYTYASLDAQAQ
SLAQALIAKGVGSEVRVAIHAERSCEYVLGILAVLKAGGTFVPLDPQLPSERLAYQLADS
GARLMLSSTACDWNGDVPVMELAFADDISAAVEHEPPVIHPQQIAYVIYTSGSTGKPKGV
AVSHGALANYVQGVLEALALLEDARNMAMVSTVAADLGHTVLFGALCTGRTLHLISPECA
FDPDAFAAYMREQRVDVLKIVPSHLRALLSAANPADVLPHERLILGGEATDWALLARIAE
LKPTCGVLNHYGPTETTVGILTQQADMADRAASTLPIGTPLANARAYVLDPWLNPVPKGV
AGELYLGGPGLAQGYLQRLGQTAERFVASPFHSGERLYRSGDRVRQLADCSLEFLGRVDD
QVKIRGYRVEPSEVAALLRDQPGVSEAEVVARENEEGRAQLYAYVVMAAGSDVEDAVLLA
QLGERVPDYMVPSALVRLEALPLTANGKLDRKALPEPVQAGSGKTFEAPQGEAEETLAAV
WADVIGCEQVGRNDNFFELGGDSILSLQIVARSRKRGYKVTPKQLMEGQTIAAVAAMATP
LVAAAPKQAAAPSKAASFALLPVQRWFFEQNFAKPHHWNQSLMLEADSGVDTALLRRAIE
AVVDHHSALRLRFERVGDSWQQAYGKLADDLLKHVDVSDHADPAQVITQAADAAQSSLSL
ARPFRAIWMALGGERGGRLLLVAHHLVVDGVSWRVILDDLQTAYAQLNAGKIVDLPPATT
SLDEWARALADYAKSEALAEQCSYWESLVKEPEPSLPAHNPHGSNTVADTASLVGSLPTE
ATTQLLGPVHKAYRTQVDDLLLTALSSALCQWAERESVLIELEGHGREDLFDGVDLSRSV
GWFTSLYPVRLSPDNAEPGTSLKAIKEQLRQVPEKGLGYGVLRYLKEEPALVGGAYPQVT
FNYLGQLDRSLQGDGAWRLAKENAGQARAPQSKRRTWIEVVAWVQDGQLRFDWNYSREIH
REEAIHALQASFQAQLEALIRHCASGVRGATPSDFPLAGLSQEQLDGLPIATDQLADIYP
LSPLQQGMLFHSLYDDQDVAYLNQLQVEITNLDIERFQRAWQNVLMRHEILRSGFLERAG
TPLQWVARTVDLPWFEADWSERADLSGALERLAEEQRAPFDLTAPPLMRSALVKIADTRH
CFIWTRHHLLLDGWSTSQLMGEVLRSYAGETLPPTEGCYRDYIAWLQRRDTDASEAYWRD
QLQHLDAPTHLVSAMPRPHEAQAGHQEITLSLDSTTTQQLESFAKAARITLNTLMQGAWS
LLVARYTGQDSVCFGATVAGRPAELPAAEQLIGPFINTLPVIVSLDPSLRVDEWLRQLQE
QNLASREHEHTPLYEIQRWAGQGGQSLFDSLLVFENYPVDAALHQNLPDELVFGEVANRE
QTNYPVTLVIFQKETLELCCGYSRSQLDDAAAEMLIQHLVGALKQLSESATRRVGEIDWL
SDGEQQQLEAWSVNDEHYNWEGPIHRLIERRSNIAPGATALIFDDQHLSYAELNTRANRL
AHYLIGFGVQPETRVGIAVERSVDMVVGLLAILKAGGAYVPLDPDYPSERLAYMVEDSGI
ELLLTQQHLRNTLPVSESLGVIELDQLDVAHHASTNPEVALHGEHLAYVIYTSGSTGRPK
GAANRHHALTNRLQWMQDAYGLTTDDAVLQKTPFSFDVSVWEFFWPLMQGARLVMAPPGA
HREPAQLVELIRSHNITTLHFVPSMLQAFLAHGKVEDCTSLTRLVCSGEALPAKLQDQVF
ARLPQVALYNLYGPTEAAIDVTHWICQDDGRNHVAIGQPIAGIRTYVLDGDLNLAPPGVA
GELYLGGIGLARGYLHRPDLTAERFVADPFAQGECLYRTGDLVRWREDGQLEYLGRLDHQ
VKIRGLRIELGEIEAELLSQPEVREAVVVAQEGPGGLRLVAYVVPQADSELDTSSLREAL
GQRLPGYMVPGVVVTLDTLPLNPNGKVDRKALPEPDLAIGSQYEPPQGEVEVALANIWSE
VLGVERVGRHDNFFDLGGHSLLALRVQARVEEHFSIRLPLRIYFEQATLVSMRESIQEWG
ESVKEEEGAQLEKMAALLDGMES
NT seq 9792 nt NT seq  +upstreamnt  +downstreamnt
atgaacagccacccgtcccataatgttgttaaccacagcttcgttgagcatttaagtcgc
ctggcccaggaaaggcccagcgacagggcgctgattgtagtgaacgctcaaggtgatacc
acccttgattacgccaccttggagcggcgttcgcgtgctttggccagcgagctacagcag
aggttcccggcgggtgagcgtgccttgatcctgctggataacgatgagcactacgtggtg
gcgttcttcgcctgcctgtatgccggggtgattgccgtgccggtcttccctccagagtcg
gccaagcagcagcatctggcgcgcctgctcgccattgccgccgactctcaggccgcctgt
gtgctcacctctacaacgattatcgatgtggtcgcatcggcaagcgaaggcttcggcagc
gccgaactgatccccgtggatgccgtagatgagagccgcgctgaacactgggtcgaacat
caccccaagcgtggtgatatcgcctttttacagtacacctcaggctccacggccacgccc
aaaggcgttatggtcagccatggcaacttgatggccaacgagcgtgctatcgagacgggc
ttctcgattggtgctgatgatgttttcgtcagttggctgccgctttaccacgacatgggg
ctgattggcggcctgctgcagcccatctatcgcggtatccctgcggtattgatgagcccc
accttctttttacagcggccggtacgctggctggaagcgatctcccgccaccggggcacc
attagcggtggccccgattttgcctatcggctgtgtcttgagcgtatccgcgacgagcag
cttgaggcgctcgatttatccagctggcgggtcgcgttctcaggcgctgagccggtacgc
cacgataccctcactggctttatcgagcgcttccgcccagcgggctttgccgctgacacc
gcagcaccctgttatggcttggccgaagcgacgctattggttagctgtaattcgcgcggt
acgggcgtggtgggcacggctttttctcaacagtcgctggccgagggaaaggctgcctca
gcggttgaaggcaacaccctggtgggctgcggtacaccggaaccttgtcacgctatcgat
attgtcgatcctgaggggcttcactcgctgcccaatggtgaagtcggcgagatctgggtc
aacgggcccagcgtggcacatgggtattggcagaatccagaagcaacagcgaaagccttt
gtcacccgcgatggggtcagttggcagcgcaccgatgatactgatgcacagaaccacgat
gctcgcgatgatcgctggctacgcaccggcgatctgggctttctgcacgaggggcagctg
tatattgccgggcgtatcaaagatctcatcattttgcgcggccataacgtctacccacag
gatatcgagagcgctatcgaggcggaagtggaagcagtgcgcaaagggcgcgtggcggcc
tttgccgtgaccacccccgaaggcgccgaaggcattggcgtcgcggcagaagtctctcgc
ggcatacagaagctagtgcccgccgagaagttggtcgaagcgctaagcgagacggtggga
tccgcttgccacgagccactttcggtagtgctactgctcaacccaggtggccttcccaaa
acctccagcggaaagctacagcgcagcgcctgccgccaaggctgggaggcgggtagcctg
gatgcctacgccattcacgcctttgggcattttgtcagtggtggtgacgctgaggacgct
ggtggtggagagtcatcacaatctactgcggaatcagggagcgaaaccgagcagacgtta
gcgatgctctggcgccaagcgctgggaaacaacaaggaaacgccactgggaagcaatgct
cacttcttcgccagcgggggtaattcgctggcggcggttcgactagccgccgccatcagt
gatcactggggcgtcgagctatctctgcacgcgctgttcgagcaaccgcgcttgtctgcc
atggctaaagctatcgaagcatgcctggcggcatcatcggatcaacgggtgctggtcatc
ccacgccttgaagatgctcaacgtcaaggcgatataccgttgtcagaagggcagcgtagc
ctatggctgacgtggcaactcgatccccagagcgctggttacaatatggcaggggcactg
cacctcaagggggtgttggatctatcagcgctcaatgcagcgctggaggcccttgttcag
cgacatgatattttacgtacttactaccccttgagtgaggcgggagaacctgttcagcgg
ctagcgcaggactggagtcctgagctgatctgcaacgatatacccggtgataccgtggtt
gaacaggagcaggcattgcatgacgcactcactcaactggcgcggcagccttttgatctt
gaacaggcgcctcctttaaacgtcgtcctctaccgcttgtccacggagcaccatgtgtta
gctgtcgtgcagcaccacattgctggcgatggatggtcagtacaggtgctcatcgatgat
ctatgcgcattttatgagagcgcctgcacacagcgagacgtcgagcttgcacctctgcca
atacagttcgcagattatgcggtttggcagcagcgtcagcagcacagtagtgagcggcag
ggccaacttgctcactggtgtgaacgcctctccggggatcatcccccgctagcgttgccc
ttggatcgcccacgccaagcgatgtccgcaccgagcgaaggccacctgcgctttacgctt
cccggtgagttgagcgagcagctacgtagcctagcccgtgaaagaaacgtttcactctat
gccgtgatcttggcgctattgaagcagacgctgtatcgctttagcggtgagacagatatc
aaggtaggggcgccgattgccaatcggcataaagccgagcttcagggcttaattgggtac
cttatcaatgtcgttgtgttgcgcactcagattgatcacactggaaatttcgaccgtttg
ttagatgaggtgaacgctaccctgatcgatgcccagctgcatcaggatgtccccttcgat
caagtggtggaggcgctacagctagaacggcaaccgggggtacatccgctatttcaggtg
aagtgtactcagcaggaaatgtggcaggcggagcgtcacgtggctggcctggccattcaa
gccgagcaggtattcacgggtattgctcacttcgatctgagtctcgatttttgcgatgag
cctgagggaataacaggtctattcgcctactccgcagagctgttcgatgccgctacgatc
gagcgtttctgtcaggcattccggtgcctggctgagcaggtcgtcgctgatccgcagtct
cacacggcgatgctggcgctacccgagcctatctccgtgctggaaggcaaccaaagcgaa
tttcttgctcaggatatacccaccctgctgtcgaaagcggtggcagctaatgctgatgag
ttagccataaacgacgggcagtaccgttatacctatgccagcctggatgcccaagcccag
agtctggcacaggcgctaatcgcaaaaggcgttggttccgaggtgcgtgttgccattcac
gccgagcgttcatgcgagtacgtgctcggcattctcgccgtacttaaagcgggtgggacg
tttgtaccgctggatccgcaactgccgagtgaacgtttggcctatcaactggctgatagt
ggtgctcgcttaatgctgagcagtacggcttgcgactggaatggtgacgttccggtaatg
gaactggcgtttgccgacgatatttcggctgcagtcgagcacgaaccacccgtcattcat
ccccagcagatcgcctatgtgatctatacctctggctccacgggcaagcctaaaggggtg
gcggttagtcacggtgctctggccaattacgtacagggcgttctggaagcgttggcgcta
ctagaggatgcccgcaacatggcgatggtctcgacggtagcggcggatctggggcatacg
gtgctgtttggtgccttgtgcaccggccgcaccttgcaccttatttcccccgagtgcgcc
ttcgacccagatgcctttgcggcttatatgcgggaacagcgggtggatgtgctcaagatt
gtgcccagccacctgcgggcactgctgagtgctgcaaacccggctgacgtgcttccgcac
gaacgcctgattctgggcggcgaagcgaccgactgggcgctactggcgcgtattgccgag
cttaagcccacctgcggggtgctcaatcactacggccccacggaaaccacggtaggtatt
ctcacccagcaagccgacatggccgatcgagctgccagcacgctgccgatcggcacaccg
ctggccaatgctcgggcctatgtgctcgatccctggcttaatccggtgccgaagggtgtt
gccggtgagctctacttgggtggcccagggctggctcaaggctatctacagcggctgggg
caaacggcggaacgtttcgttgcaagccccttccattcgggggagcggctctatcgcagc
ggtgaccgcgtgcgccaactggccgactgtagcctggagttccttggccgtgtggatgat
caggtcaagattcgcggctatcgggtggaaccgagcgaggtcgctgccctgttgcgcgac
cagccaggggtctcggaggccgaagtggtcgctcgggaaaatgaggaaggacgcgcgcaa
ctgtacgcttatgtggtgatggcagccgggagcgacgttgaagatgctgtgttactcgcg
cagcttggcgagcgcgtgccggactatatggttcccagcgccctggtacggctggaggct
ctgccactaaccgccaatggcaagctggatcgcaaggcgctgcccgagccagtgcaagcc
ggtagtggtaaaacctttgaagcgccccagggagaagcagaagagacgttggcagcggtc
tgggctgacgtgatcggctgcgagcaggtggggcgcaacgacaacttcttcgagctgggt
ggtgactccatcctcagcttgcagatcgtcgcgcgctcgcgtaagcgtggctacaaggta
acgcccaagcagttgatggaagggcagaccattgccgcagtggcggcgatggccacgccc
ttggtggctgccgcacctaaacaagcggctgcgcccagcaaggctgcttcctttgcgctg
ctgccggtacagcgctggttcttcgagcagaactttgccaagccacaccactggaatcag
tcgttgatgctggaagcggacagtggtgtagataccgcgctgctacggcgtgccattgag
gcagtggtagatcaccatagcgccttgcggctgcgctttgagcgcgttggcgatagctgg
caacaagcctatggcaagctagccgacgatctcctcaagcacgtggacgtaagcgatcat
gcggatccggcgcaggtcatcacccaggctgccgatgctgcgcaaagcagtctgagtttg
gcgcggccgttccgtgctatctggatggcactgggaggcgagcgcggcggacgattgctg
ctagtggctcaccacctggtggtggacggcgtctcgtggcgcgtgatcctcgacgacctg
caaacggcctacgcgcagttaaatgcaggaaagatagtcgacctaccaccggcaaccacc
tcgctagatgagtgggcgcgtgccctggccgactatgccaaatcggaggctttggctgag
caatgctcctattgggagagccttgtcaaagagccagagcctagcctacctgcacataat
ccccatggcagcaacaccgtcgccgataccgcatcgctcgttggcagtttgcctaccgag
gcgaccacgcaactattggggccggtgcataaagcataccgcacccaggtggatgacctg
cttctcactgcactatcgagcgccctgtgccaatgggcagagagagagagcgtactgatt
gagctggaaggccatggccgcgaagacctgttcgacggtgtcgatctcagtcgcagcgta
ggttggttcacctcgctctacccggttcgcctgagcccagataatgcggagcccggcaca
agcctaaaagcaatcaaagagcaacttcgccaagtgcctgaaaaggggctcggctacggc
gtgctgcgctatttgaaagaagagcccgcgctggtcggtggtgcctacccccaggtcacc
ttcaattatctaggccagttggatcgctccctacagggcgatggggcctggcggctcgcc
aaagagaatgcagggcaggctcgcgcgccgcaaagcaagcgccgtacctggattgaggtg
gtggcctgggttcaagatggccaactgcgcttcgactggaattacagtcgtgagattcac
cgcgaggaagcgatacacgccttgcaagcaagcttccaagcgcaacttgaggcactgatt
aggcactgtgctagtggcgttcgtggcgcaacaccttcggacttcccgctggcggggctg
agtcaagagcagctggacggcttgcctattgccaccgaccaactggcggatatctatccg
ctgtcaccactccagcagggcatgctgttccatagcctctacgatgaccaagatgtggcc
tatctcaaccagttgcaggtagagattaccaacctggatatcgaacgcttccagcgcgcc
tggcaaaacgtactcatgcgccatgagatattacgcagcggcttcctggagcgagctgga
acgccgctgcagtgggtcgcacgtaccgtcgacttgccgtggttcgaggcggattggagc
gaacgagcggatctatcaggagcgcttgagaggctggccgaggagcaacgggcgccattc
gatctgacggcgccgcccctgatgcgttcggcgctggtgaaaatagcagatacccggcac
tgctttatctggacgcgccaccatctgctgctggatggctggagtacctcgcaactgatg
ggtgaggtattgcgcagttacgcaggggagactctgccacctacagaggggtgctatcgc
gattacatcgcttggctccagcgccgtgacactgatgccagtgaagcctactggcgtgac
caattacagcatctcgatgcgcctacgcatctcgtcagcgccatgcctagaccccatgaa
gcgcaagctgggcatcaagagatcaccctgtcactggatagcacgaccactcagcaactg
gagagtttcgccaaagcggctcgcataacgctcaatacgctaatgcaaggcgcctggtcg
ctgctggtggcacgttacacggggcaagatagcgtctgttttggcgcgaccgtagccggg
cgacctgcggagctaccggcggcagagcagttgatcggccccttcatcaataccttaccg
gtcattgtctcactagatccctcgcttcgcgtcgatgagtggttgcgccagttgcaggaa
caaaacctggcgagtcgtgaacatgagcatacgccgctttacgagatccaacgttgggcg
gggcagggtggccagtcgctgttcgatagtttgctggtattcgagaactatcccgttgat
gcagcattgcatcagaacctgccggatgaattggtgttcggcgaggtggccaaccgcgaa
cagaccaattaccccgtcacgctggtgattttccagaaggaaacgttggagctttgctgt
ggctattcacgatcacagttagatgatgccgctgccgagatgttgatccagcatctggta
ggagcgcttaaacagttgagtgagtcggccactcgacgagtcggtgaaatcgactggtta
agtgacggtgagcagcaacagcttgaggcgtggagcgttaatgatgagcattataactgg
gagggcccgatccatcgtttgattgagcgtcgttccaatatagcgcctggagctacagcc
ctcattttcgatgatcagcatctcagctacgccgagcttaacacccgggccaatcgcttg
gcccactatctgattggttttggcgtacaacctgagactcgagtaggcatcgctgttgag
cgctccgtcgatatggtggtggggctgctggctatcctcaaggcgggtggcgcctatgta
ccgttggatccggattatccgagcgagcggctggcctatatggttgaagacagcggtatt
gagctgctgcttacccaacagcaccttcgcaatacgttgccggtgtctgagagccttggc
gttatcgagctggatcaattggacgtggcgcatcatgcgtcaaccaacccggaggtggca
ctgcacggtgaacatctcgcctatgtcatttacacctcgggttctaccgggcgccctaag
ggtgcggccaaccgtcatcacgcgctgaccaaccgcctgcagtggatgcaagacgcctat
gggctgacgaccgacgatgcggtgctgcagaaaacgccattcagtttcgatgtctcggta
tgggagttcttctggccgctgatgcagggggcgcggctggtgatggcgccgccgggagcc
catcgcgaaccggcacaattggtcgagctaatccgtagccataacatcactacactgcac
tttgtaccttcaatgcttcaggccttcttggctcatggcaaggttgaagactgcaccagt
ctgacgcgcttggtatgcagcggtgaggcgctgccggccaaactgcaggatcaggtattt
gcccgcttacctcaagtggcgctctacaacctctacggccccaccgaagcggccattgat
gtcacccactggatctgccaagacgatgggcgcaaccacgtagctatcggtcaacccatc
gccggtatccgcacctacgtgctggatggagatcttaacttagcgccaccgggagttgcg
ggggagctctatctcggaggcattgggttggcacggggctatctgcaccgccctgacctt
accgcagaacgttttgtcgccgatccatttgcgcagggcgaatgtctctaccgcaccggc
gacctagtgcgctggcgggaagatggtcagctcgagtacctgggccgcctcgatcaccag
gtgaagatccgcggcctgcgtatcgagcttggcgagatcgaagccgaactactctctcag
ccggaggttcgcgaggcagtggtagtcgctcaagaaggccccggtggtttgaggctggtg
gcctatgtggtgccccaggccgacagtgaactcgacactagttcactgcgtgaagcgctg
gggcagcgactgccgggctatatggtgccgggagtcgtggtcacgctcgatacgttacca
ctgaaccccaacggcaaggtggatcgcaaggcgctacctgagccggatttggccattggc
tcgcagtacgagccgcctcaaggcgaggtggaagtggcactggcgaatatctggtcagaa
gtccttggcgtcgagcgtgtggggcgtcatgacaactttttcgacttaggggggcactcg
ttattggctttaagagtgcaagccagagtggaggaacatttctctatacgacttcccctg
cgtatctatttcgagcaggccactttggtctcgatgcgtgagtccattcaggagtggggt
gaaagcgtgaaagaggaagagggcgcacagctcgaaaagatggcggcgctattagatggt
atggagagctga

DBGET integrated database retrieval system