KEGG   Halobacterium salinarum NRC-1: VNG_2513GHelp
Entry
VNG_2513G         CDS       T00038                                 

Gene name
aldY1
Definition
(GenBank) aldehyde dehydrogenase (retinol)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
hal00010  Glycolysis / Gluconeogenesis
hal00053  Ascorbate and aldarate metabolism
hal00071  Fatty acid degradation
hal00280  Valine, leucine and isoleucine degradation
hal00310  Lysine degradation
hal00330  Arginine and proline metabolism
hal00340  Histidine metabolism
hal00380  Tryptophan metabolism
hal00410  beta-Alanine metabolism
hal00561  Glycerolipid metabolism
hal00620  Pyruvate metabolism
hal00625  Chloroalkane and chloroalkene degradation
hal01100  Metabolic pathways
hal01110  Biosynthesis of secondary metabolites
hal01120  Microbial metabolism in diverse environments
hal01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG_2513G (aldY1)
   00053 Ascorbate and aldarate metabolism
    VNG_2513G (aldY1)
   00620 Pyruvate metabolism
    VNG_2513G (aldY1)
  Lipid metabolism
   00071 Fatty acid degradation
    VNG_2513G (aldY1)
   00561 Glycerolipid metabolism
    VNG_2513G (aldY1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VNG_2513G (aldY1)
   00310 Lysine degradation
    VNG_2513G (aldY1)
   00330 Arginine and proline metabolism
    VNG_2513G (aldY1)
   00340 Histidine metabolism
    VNG_2513G (aldY1)
   00380 Tryptophan metabolism
    VNG_2513G (aldY1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VNG_2513G (aldY1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VNG_2513G (aldY1)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     VNG_2513G (aldY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAG20575
UniProt: Q9HMJ6
LinkDB All DBs
Position
1883735..1885204
Genome map
AA seq 489 aa AA seqDB search
MSDLDFGDVDWNVQYIDGEYVPPGDRGTLEVDDPSTRELFTEIPAGTTDDVDAAYEAAAD
AQTEWADTPPQERARIVAAASEILASHRDEVVDLLATESGTTYTKGAAEFEASVGITDEA
ASFPTRMNGDHKQSVVEGKENIVVREPQGVVGIISPWNFPLNLSIRAVAPAVAAGNSVVL
KPASNTPVTGGLLIAKVFEAAGLPEGVFNVVTGKGSEIGDRIAGHPHADVISFTGSTAIG
RQVAATAGENLALPAMELGGNNVHIVTEDADLDDAVDSGVFGSFLHSGQICISINRHVVH
EDVYDEYVERLTERAAALPTGTAHDADTVVGPIIDESQRDQILDYIERTVDAGATLETGG
DHDGLVVEPTVLSDATNDMAAACNEHFGPVAPVIPFSDDDEAVEIANSTEYGLSGSVHAG
DTGRARDIADRIDTGMIHINDQPVNQEPHLPFGGYKNSGLGRYNGEYVLNEFTQEKWVSI
QRETRDYPF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccttgacttcggtgacgtcgactggaacgtacagtacatcgacggtgagtac
gtcccgccgggagaccgggggacgctcgaagtcgatgacccatcgacacgcgagctgttc
actgagatcccagccgggacgactgacgacgtcgacgccgcctacgaggccgccgcggac
gcacagacggagtgggctgacacgccgccccaggagcgtgcgcgcatcgttgcggcggcg
agcgagatcctcgcatcccatcgcgacgaggtcgtcgacctgctggcgacggagtccgga
accacgtacacgaagggcgcggccgaattcgaggcgtcggtcgggatcaccgacgaggcg
gcgtcgttcccgacgcggatgaacggcgaccacaagcagtccgtggtcgagggcaaggag
aacatcgtggtgcgtgagccccagggtgttgtggggatcatctcgccgtggaacttcccg
ctgaacctctcgatccgcgcggtcgcgccggcggttgcggccggcaacagcgtcgtgctc
aagccggcgtcgaacacgccggtgaccggcggcctgctcatcgcgaaggtgttcgaggct
gcggggctgcccgagggcgtgttcaacgtcgtcacggggaagggcagcgagatcggtgac
cggatcgccggtcacccccacgccgacgtgatctcgttcactgggtcgaccgcgatcggc
cgccaggtcgccgcgacggcgggcgagaacctcgcgctgccggcgatggagctcggcggg
aacaacgtccacatcgtcacggaggacgcggacctcgacgacgccgtggacagcggggtt
ttcggatcgttcctgcactccgggcagatctgcatctcgatcaaccgccacgtcgtccac
gaggacgtctacgacgagtacgtcgagcgcctcacggagcgtgcggccgcgttgccgacc
gggacggcccacgacgccgacacggtcgttggcccgatcatcgacgagagccagcgcgat
cagatcctggactacatcgagcggactgtcgacgcgggcgcgacgctcgagaccggcggg
gaccacgacggcctcgtcgtcgagccgaccgtgctctcggacgccaccaacgacatggcg
gcggcgtgcaacgagcacttcgggccggtcgcgccggtgatcccgttctccgacgacgac
gaagccgtggagatcgcaaacagcaccgagtacgggctttcgggcagcgtgcacgcgggc
gacaccggtcgggcgcgtgacatcgccgaccgcatcgacaccggcatgatccacatcaac
gatcagcccgtcaaccaggagccccaccttcccttcggcgggtacaagaactccgggctc
ggccggtacaacggcgagtacgtcctcaacgagttcacccaggagaagtgggtgagcatt
cagcgcgagacccgcgactacccgttctaa

DBGET integrated database retrieval system