KEGG   Halobacterium salinarum NRC-1: VNG_2513GHelp
Entry
VNG_2513G         CDS       T00038                                 

Gene name
aldY1
Definition
(GenBank) aldehyde dehydrogenase (retinol)
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hal  Halobacterium salinarum NRC-1
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:hal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VNG_2513G (aldY1)
   00053 Ascorbate and aldarate metabolism
    VNG_2513G (aldY1)
   00620 Pyruvate metabolism
    VNG_2513G (aldY1)
  Lipid metabolism
   00071 Fatty acid degradation
    VNG_2513G (aldY1)
   00561 Glycerolipid metabolism
    VNG_2513G (aldY1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VNG_2513G (aldY1)
   00310 Lysine degradation
    VNG_2513G (aldY1)
   00330 Arginine and proline metabolism
    VNG_2513G (aldY1)
   00340 Histidine metabolism
    VNG_2513G (aldY1)
   00380 Tryptophan metabolism
    VNG_2513G (aldY1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VNG_2513G (aldY1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VNG_2513G (aldY1)
Enzymes [BR:hal01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     VNG_2513G (aldY1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1883735..1885204
Genome map
AA seq 489 aa AA seqDB search
MSDLDFGDVDWNVQYIDGEYVPPGDRGTLEVDDPSTRELFTEIPAGTTDDVDAAYEAAAD
AQTEWADTPPQERARIVAAASEILASHRDEVVDLLATESGTTYTKGAAEFEASVGITDEA
ASFPTRMNGDHKQSVVEGKENIVVREPQGVVGIISPWNFPLNLSIRAVAPAVAAGNSVVL
KPASNTPVTGGLLIAKVFEAAGLPEGVFNVVTGKGSEIGDRIAGHPHADVISFTGSTAIG
RQVAATAGENLALPAMELGGNNVHIVTEDADLDDAVDSGVFGSFLHSGQICISINRHVVH
EDVYDEYVERLTERAAALPTGTAHDADTVVGPIIDESQRDQILDYIERTVDAGATLETGG
DHDGLVVEPTVLSDATNDMAAACNEHFGPVAPVIPFSDDDEAVEIANSTEYGLSGSVHAG
DTGRARDIADRIDTGMIHINDQPVNQEPHLPFGGYKNSGLGRYNGEYVLNEFTQEKWVSI
QRETRDYPF
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccttgacttcggtgacgtcgactggaacgtacagtacatcgacggtgagtac
gtcccgccgggagaccgggggacgctcgaagtcgatgacccatcgacacgcgagctgttc
actgagatcccagccgggacgactgacgacgtcgacgccgcctacgaggccgccgcggac
gcacagacggagtgggctgacacgccgccccaggagcgtgcgcgcatcgttgcggcggcg
agcgagatcctcgcatcccatcgcgacgaggtcgtcgacctgctggcgacggagtccgga
accacgtacacgaagggcgcggccgaattcgaggcgtcggtcgggatcaccgacgaggcg
gcgtcgttcccgacgcggatgaacggcgaccacaagcagtccgtggtcgagggcaaggag
aacatcgtggtgcgtgagccccagggtgttgtggggatcatctcgccgtggaacttcccg
ctgaacctctcgatccgcgcggtcgcgccggcggttgcggccggcaacagcgtcgtgctc
aagccggcgtcgaacacgccggtgaccggcggcctgctcatcgcgaaggtgttcgaggct
gcggggctgcccgagggcgtgttcaacgtcgtcacggggaagggcagcgagatcggtgac
cggatcgccggtcacccccacgccgacgtgatctcgttcactgggtcgaccgcgatcggc
cgccaggtcgccgcgacggcgggcgagaacctcgcgctgccggcgatggagctcggcggg
aacaacgtccacatcgtcacggaggacgcggacctcgacgacgccgtggacagcggggtt
ttcggatcgttcctgcactccgggcagatctgcatctcgatcaaccgccacgtcgtccac
gaggacgtctacgacgagtacgtcgagcgcctcacggagcgtgcggccgcgttgccgacc
gggacggcccacgacgccgacacggtcgttggcccgatcatcgacgagagccagcgcgat
cagatcctggactacatcgagcggactgtcgacgcgggcgcgacgctcgagaccggcggg
gaccacgacggcctcgtcgtcgagccgaccgtgctctcggacgccaccaacgacatggcg
gcggcgtgcaacgagcacttcgggccggtcgcgccggtgatcccgttctccgacgacgac
gaagccgtggagatcgcaaacagcaccgagtacgggctttcgggcagcgtgcacgcgggc
gacaccggtcgggcgcgtgacatcgccgaccgcatcgacaccggcatgatccacatcaac
gatcagcccgtcaaccaggagccccaccttcccttcggcgggtacaagaactccgggctc
ggccggtacaacggcgagtacgtcctcaacgagttcacccaggagaagtgggtgagcatt
cagcgcgagacccgcgactacccgttctaa

DBGET integrated database retrieval system