KEGG   Halomonas sp. 1513: BWR19_05835Help
Entry
BWR19_05835       CDS       T04761                                 

Definition
(GenBank) peroxidase
Organism
halo  Halomonas sp. 1513
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-ProteinID: APX92498
UniProt: A0A1P8R1F4
LinkDB All DBs
Position
1272297..1274105
Genome map
AA seq 602 aa AA seqDB search
MFGQRGSGLLGRAFRRINRRRQWYRFPFLIAVLNLVALRRNLRWHNLYSTERERPQDPER
ENIDVRQFRTADGSYNDLAEPAMGKAYTRFGRNVPPAETFGETGERLMTPSPRVISRRLM
TRNAFVPATSLNVLVPAWLQFMVHDWFSHGSNDTEAERYEVPLDEDDDWPWERMTVLRSR
RDTTRSAADEGHPDTFLNTETQWWDASQIYGSNLRRQRLVRTDPDSGELLSDGKLYLRPD
GHLPLDEHGIELAGANGNWWIGLSLMHTLFAMEHNAIVDRLRIEHPDRDGEWLFQKARLV
NAALIAKIHTVEWTPALLDTPELRLGMRSNWWGVLDEHFYRSRGRVSDSELFSGIVGSPV
DHHAAPYAITEEFSAVYRMHPLIPDDFSFRRLDDDTLIKECGLTEVAGSLTQALYKEMSL
SDALYSLGTSHPGALVLHNFPSHLQQHEKQAPHHRMIDLATVDVLRDRERGVPRYCRFRR
LIDMPAPASFAELTDNPEWQRELEAVYGDIEEVDLLIGCLAETPPPGFAFSDTAFRIFIL
MASRRLKSDRFFTDDYTPEVYTRAGMEWIDNNHMASVIARHFPELAPRLEGVRNAFFPWN
RG
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgttcggtcagcgtggaagcggtctgctcggtcgtgcctttcggcggatcaatcggcgc
cgtcagtggtatcgatttcccttcctcatcgccgttctcaatctcgtcgctctgcgccgc
aacctgcgctggcataacctctactccaccgaacgggagcgtccgcaggatcccgagcgg
gaaaacatcgacgtccgccagttccgcaccgccgacggcagctacaacgacctggcggaa
cccgccatgggcaaggcgtatacccgcttcgggcgcaacgtgccgcccgccgagaccttc
ggcgagaccggcgagaggctgatgacaccgagtccccgggtgatcagtcgacgcctgatg
acccgcaatgccttcgtgcccgcgaccagcctcaacgtgctggtgccggcctggctgcag
ttcatggtccacgactggttcagccacggtagcaacgacaccgaggccgagcgctacgag
gtgcccctggacgaggacgatgactggccctgggagcgcatgacggtgctgcgcagccgg
cgcgacaccacccgctccgccgccgacgaggggcatcccgacaccttcctcaacaccgag
acccagtggtgggacgcctcgcagatctacggcagcaatctacgccgacagcgcctggtg
cgcaccgaccccgacagcggcgaactgctctccgacggcaagctctacctgcggcccgat
ggccatctgccgctggatgaacacggcatcgaactggcgggcgccaacggcaactggtgg
ataggactgtcgctgatgcacaccctgttcgccatggagcacaacgccatcgtcgaccgg
ctgcgcatcgagcaccccgaccgcgacggcgagtggctgttccagaaggcgcggctggtg
aatgcggcgctgatcgccaagatccataccgtcgagtggacgccggcgctgctcgacacc
ccggagctgcgcctgggcatgcgatccaactggtggggcgtgctcgacgagcacttctac
cgcagccggggacgtgtcagcgacagtgaactgttcagcggtatcgtcggctcgccagtg
gatcaccatgccgcaccctatgctatcaccgaggagttcagtgccgtttatcgcatgcac
ccgctgattcccgacgatttcagcttccggcgtctggacgacgacaccctgatcaaggag
tgcggcctcaccgaggtggccggctctctgacccaggcgctgtataaagagatgtcgctc
agcgatgcgctctactcgctgggcaccagccatcccggcgccctggtgctgcacaatttc
ccgagtcacctgcagcagcacgagaagcaggcgccccatcatcgaatgatcgacctggcc
acggtggatgtgcttcgcgaccgcgagcgcggggtgccgcgctactgccgcttccgccgc
ttgatcgacatgccggccccggcgagctttgccgagctgaccgacaaccccgagtggcag
cgcgagctggaggcggtctacggcgacatcgaggaggtcgacctgctgatcggctgcctg
gccgagaccccgccgcccggcttcgccttcagcgataccgccttccggatcttcatcctg
atggcctcgcgacgcctcaagagcgaccgcttcttcaccgacgactacacccccgaggtc
tacacccgggcggggatggagtggatcgacaataaccatatggcgtcggtcatcgcacgc
cacttccccgaactggcgccgcggctggagggcgtacgcaatgccttcttcccgtggaac
cgtggttaa

DBGET integrated database retrieval system