KEGG   Halomonas sp. 1513: BWR19_15390Help
Entry
BWR19_15390       CDS       T04761                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
halo  Halomonas sp. 1513
Brite
Enzymes [BR:halo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BWR19_15390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: APX94207
UniProt: A0A1P8R6C3
LinkDB All DBs
Position
complement(3394592..3395131)
Genome map
AA seq 179 aa AA seqDB search
MKKGHAVLIGMTLGAFSLTSMAEEGNGPTASVEFIDNHGEVVGEGTIDQGPAGVLINFSI
DGLDEGWKAIHIHSVGTCEDHEEGFQDSGGHLNPDDSEHGFLNPDGPDAGDLPNFYVHSD
GSAMVEMFNERASLDGSVGGNMLDDDGSALVIHENPDDHMSQPIGGAGDRVACGVVQGG
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagggacatgcagtactgatcggtatgacacttggggccttctccctgacgagc
atggccgaggagggcaacggcccgaccgccagcgtcgagttcatcgataaccacggtgaa
gtggtgggggaaggcacgatcgatcagggcccggccggggtgctgatcaacttcagcatc
gatggcctggacgagggctggaaggccattcacatccatagcgtcggtacctgcgaggat
cacgaggaggggttccaggactctggtggccacctcaatcccgatgactcagagcacggc
ttcctcaatcctgacggacctgacgccggcgacctgcccaacttctacgtccacagcgac
ggcagcgcgatggtcgagatgttcaatgagcgggcaagcctcgacggtagcgtcggtggc
aacatgctcgacgatgacggcagtgcgctggtcatccacgagaaccccgatgaccacatg
agccagcccatcggcggtgccggcgaccgggtcgcctgtggcgtcgtgcagggcggctga

DBGET integrated database retrieval system