KEGG   Halomonas sp. R57-5: HALO0607Help
Entry
HALO0607          CDS       T04029                                 

Definition
(GenBank) Aminotransferase class-III
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
ham  Halomonas sp. R57-5
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HALO0607
   00650 Butanoate metabolism
    HALO0607
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HALO0607
   00280 Valine, leucine and isoleucine degradation
    HALO0607
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    HALO0607
Enzymes [BR:ham01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     HALO0607
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     HALO0607
Amino acid related enzymes [BR:ham01007]
 Aminotransferase (transaminase)
  Class III
   HALO0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(646728..648020)
Genome map
AA seq 430 aa AA seqDB search
MNTDAXPSHSMLRQREQCIPRGVVNAHPIVISHARGSEVFDADGQRYLDFVGGIGVLNVG
HNHPRVVAAVQAQVERISHMSFQVAAYPGYIKLASQLAQLVGGDNAYQSVLFTSGAEAVE
NAIKIARSHTGRPNVIAFRGGFHGRTLLGTTLTGMSQPYRQNFGPFAPAIHHVSYPDALR
GVSSEDVLAELDTLFATEVVPDQVAAILIEPVQGDGGFLPAPVAFMQALRALTERHGIVL
IADEIQTGFGRTGKMFGFEHSNIQPDLVTVAKSLGGGLPISGVVGRTEIMQAPAPGGLGG
TYGGSALSCAAALAVLDIFADEQLLERGIAMGKRLETGLRRLQAKHPVIAEVRGQGPMLA
IELLKGPRVTPEDAALVQQVIDHCREAGLLVIKCGVYRNVIRFLAPLTTSDQQTDEALEI
LDDALSNATH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaataccgatgcccmcccttctcactcaatgctacgccagcgggagcagtgcattccc
cgcggtgtggtcaatgcccatcctattgtcatttcccatgctcgcggtagcgaagtcttc
gacgcggatggccaacgctatctggattttgtcggcgggatcggcgtactcaacgtaggc
cacaatcacccccgcgtcgttgctgcggttcaggcccaagtggaacgtatttcccacatg
agtttccaggtggcggcctacccaggctatataaaactggctagccagctggctcagttg
gtcggtggtgacaacgcctaccaaagcgtgctctttacctccggcgctgaagcagtggaa
aacgccatcaaaattgcccgttcccacacgggacgccccaacgtgattgcctttcgcggt
ggctttcatggacgcacgctgctgggcaccacgctaaccggcatgagccagccctatcgg
caaaactttggcccttttgcccccgctattcaccacgttagctacccggatgcgctgcgg
ggtgttagcagtgaggatgtgcttgccgagctggatacgctgttcgccactgaagtcgtc
cccgaccaggttgccgctatcctgattgagcccgttcagggtgatggcggttttcttcct
gccccagtcgcgtttatgcaggcgcttcgcgctttaaccgaacgccacggcatcgtgctg
atcgccgatgagattcagaccggcttcgggcgcacgggcaagatgtttggctttgaacac
agcaatattcagcctgaccttgtcactgttgctaaaagcctgggcggaggcttgccgatt
tcaggcgtggttgggcgcactgagatcatgcaagctcccgcgccgggtgggctcggcggc
acctatgggggcagcgcgctgagctgcgcggcagcactggcggtgctagatatttttgca
gacgagcaactgcttgagcgtggtatcgccatgggaaaacgcctggaaacagggctgcgt
cggctgcaagccaaacatcctgtgattgccgaggtacgtgggcaaggcccgatgcttgct
atcgagcttctcaagggcccacgggtaacacctgaagacgctgcgctagtgcaacaggtc
attgatcactgtcgtgaagcgggtttgctggtgattaagtgcggtgtataccgcaatgtg
atccgctttctggcaccgctgactaccagcgaccagcaaaccgacgaagcactagagatt
ttggacgacgcgctatccaacgccacgcactaa

DBGET integrated database retrieval system