KEGG   Halomonas sp. R57-5: HALO1617Help
Entry
HALO1617          CDS       T04029                                 

Definition
(GenBank) Putative Phosphoenolpyruvate mutase
  KO
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ham  Halomonas sp. R57-5
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ham00001]
 Metabolism
  Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    HALO1617
Enzymes [BR:ham01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     HALO1617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(1755827..1756762)
Genome map
AA seq 311 aa AA seqDB search
MCLQYRTLPDSRRGKLKKQLDEKGHVRCIEVHNGLSALVCSEATNYAIEGSSPNFDALWI
SSLTGSASRGLPDMEMYVLERRLELIDEVCQASMKPIIVDGDTGGETTSFEYLCTRLESL
GVSAVVIEDKQHPKRNSLSLDSRHVLEEPNAFGAKIRRARSALLSDTFMIFARLESLIAG
RTVDDALERAEIYLRNGAHGVMIHSKSKDGDDIIEFITRFRSAGHKEPIICVPTTYNKIR
AQDLFEHGANIVIHANHMLRASHFAMKKVCKRILENDRSFEADGICSSVGDIFSLVGYDA
ALAREKQSTDA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtgtctacaatataggaccttgccagatagccgtcggggtaaactcaaaaaacaatta
gatgaaaaaggccatgtgagatgtatagaagtgcataacgggctttcagcgcttgtgtgt
agtgaagcgacaaactacgcaattgaaggatcctcgccaaattttgacgctctctggatt
tcaagtttaactgggtctgcatccagagggttgcctgatatggaaatgtacgtgctggag
agaagactcgagttaatagacgaagtttgccaagcgtctatgaagccgattattgtggac
ggtgatacgggtggagaaacaacaagttttgagtatttgtgcactaggttagaatcatta
ggggtcagcgcagtagtaattgaagacaaacaacaccctaagcggaatagcctgtcatta
gattcgcggcacgtccttgaagagccaaatgcttttggcgcaaaaattagacgtgcgcgc
tctgcattgctatccgacacctttatgatttttgcacggcttgaaagcttaatagctgga
cgtaccgtagacgatgcactggagagagccgaaatatacctgcgtaatggtgcgcatgga
gtaatgattcattctaaatcaaaggatggcgatgatattatagagttcattaccagattt
agaagcgcgggccacaaagaaccaattatatgtgtgcctactacctacaacaaaataaga
gcccaggacctatttgagcatggtgccaatattgtaatacacgctaaccatatgctaaga
gcatcgcattttgcaatgaagaaagtttgcaaaagaatcctagaaaatgatcgttctttt
gaagcagatggtatctgcagctcggtcggtgatattttcagtctggttggttacgatgca
gctctagcaagggaaaaacaatctacagacgcctaa

DBGET integrated database retrieval system