KEGG   Halomonas sp. R57-5: HALO3667Help
Entry
HALO3667          CDS       T04029                                 

Definition
(GenBank) Amino acid adenylation
Organism
ham  Halomonas sp. R57-5
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(3999231..4011488)
Genome map
AA seq 4085 aa AA seqDB search
MNIRHAQTMNSHPSHNVVNHSFVEHLSRLARERPSDRALIVVNAQGETTLDYATLERRSR
ALASELQQRFPAGERALILLDNDEHYVVAFFACLYAGVIAVPVFPPESAKQQHLARLLAI
AADSQAACVLTSTTIIDVVASASEGFGSAELIPVDAVDESRAEHWIEHRPKRGDLAFLQY
TSGSTATPKGVMVSHGNLMANERAIETGFSIGADDVFVSWLPLYHDMGLIGGLLQPIYRG
IPAVLMSPTFFLQRPVRWLEAISRHRGTISGGPDFAYRLCLERIRDEQLEALDLSSWRVA
FSGAEPVRHDTLTGFIERFRPAGFAADTAAPCYGLAEATLLVSCNSRGTGVVGTAFSQQS
LAEGKAVSAVEGNTLVGCGTPEPGHAIDIVDPEGLHSLPSGDVGEIWVNGPSVAHGYWQN
PEATAQAFVTRDGVSWQRTDDADAQNHDARDDRWLRTGDLGFLHEGQLYIAGRIKDLIIL
RGHNVYPQDIESAIEAEVEAVRKGRVAAFAVTTPEGAEGIGVAAEVSRGIQKLVPAEKLV
EALSETVGSACHEPLSVVLLLNPGGLPKTSSGKLQRSTCRQGWEAGSLDAYAIHAFGRFV
SDGDAEGGGKSSPSPAEAGSETEQALAKLWHQVLGDDDTQSQSKPLGSDAHFFASGGNSL
AAVRLAATISDYWGVELSLHSLFEQPRLSAMAKAIEARLAASSDQRGMAIPRLEDDQRQG
DIPLSEGQRSLWLTWQLDPQSAGYNMAGALHLKGVLDPSSLNAALEDLVQRHDILRTYYP
LSEAGEPVQRLAQDWHPELICDEMPGDTVDEREQALHDALTKLARKAFALDQAPPLTIAL
YRLSTEHHVLAVVQHHIAGDGWSVQVLIDDLCALYEGACTQQEVKLAPLPVQFADYAVWQ
QRQKHSSERHSSERQGQLAHWCERLSGDHPPLALPLDRPRQAMSAPSEGQLRFTLPGELS
EQLRSLARERNVSLYAVILALLKQTLYRFSGETDIKVGAPIANRHKAELQGLIGYLINVV
VLRTQIDPTGNFERLLDEVNATLIDAQLHQDVPFDQVVEALQLERQPGVHPLFQVKCTQQ
EMWQAERHVAGLVIQAEQVFTGIAHFDLSLDFCDEPEGIAGLFAYSAELFDATTIERFCQ
AFRFLAEQVVADPRSHTAMLSLPEPISVLEGNQSEILTQAIPTLLSKVVVAHADELAVND
GQYRYTYASLDAQAQSLAQALIAKGVGSEVRVAIHAERSCEYVLGILAVLKAGGAFVPLD
PQLPRERLAYQLADSGARLMLSSTACDWSDAVPVMELAFXDDVPAAVENKSPVIHLQQTA
YVIYTSGSTGKPKGVAVSHGALANYVQGVLEALALPEGARNMAMVSTVAADLGHTVLFGA
LCTGRTLHLISPECAFDPDAFAAYMREQRVDVLKIVPSHLRALLSAATPADVLPHERLIL
GGEATDWALLERIAELKPTCQVLNHYGPTETTVGILTQQADIADRAASTLPIGTPLANAQ
AWVLDPWLNPVPKGVAGELYLGGPGLAQGYLQRLGQTAERFVASPFHAGERLYRSGDRVR
QLADGSLTFLCRVDDQVKIRGYRVEPSEIATLLRDQPCIAEAEVVARENEEGRAQLFAYV
VMAAGSDIDDAALLAQLGERVPDYMVPSAIVRLDALPLTANGKLDRKALPEPVQAGGGKA
FEAPQGAAEETLAAVWADVIGCEQVGRNDNFFELGGDSILSLQIVARSRKRGYKVTPKQL
MEGQTVAAVAAMATPLAATAPKQAAAPNKAASFALLPVQRWFFEQNFAEPQHWNQSLMLE
AASGVDTALLRRAIEAVVDHHSALRLRFERVGDSWQQAYGKLADDLFEHVDVSDHADPAQ
AITQAADAAQRSLSLARPFRAIWMALGGERGGRLLLVAHHLVIDGVSWRVILDDLQAAYA
QLSAGKTVDLPPATTLLDEWARALADYAKSEALAEQCSYWESLVTAPEPSLPARNPHGSN
TVADTASLVGSLPTEATTQLLGPVHKAYRTQVDDLLLNALSSALCQWAERDSVLIELEGH
GREDLFDGIDLSRSVGWFTSLYPVRLTPGNAEPGTSLKAIKEQLRQVPEKGLGYGVLRYL
KEEPALVGGAYPQVTFNYLGQLDRSLQGDGAWRLAKENAGQARAPQSKRRTWIEVVAWVQ
DGQLRFDWNYSREIHSEAAIHALQVSFQAQLEALIEHCASGVRGATPSDFPLAGLSQEQL
DGLPVDTXQLADLYPLSPLQQGMLFHSLYDDQDSAYLNQLQVEIDDLDVKRFQLAWQAVL
ARHEVLRSGFLESAGMPLQWVARNVDLPWFEVDWRERVDLKAALERLSQEQRKPFDMTAP
PLMRLALVRIAETRYCFIWTRHHLLLDGWSTSQLMGEVLRCYAGEALPSAEGRYRDYIAW
LQRRDTNASETYWRDQLQRLDAPTHLVSTXPRPYEAQAGHQEITLSLDSTTTQRLEGFAK
ATRITLNTLMQGAWALLVARYTGQDSICFGATVAGRPAELPAAENLIGPFINTLPVIVSL
NPSLRVNEWLCQLQAQNLASREHEHTPLYEIQRWAGQGGQALFDSLVVFENYPVDAALHQ
NLPGGLTFGEVDNREQTNYPVTLVVFHKEALELCCGYSRSQLDDAAAEILIQHLVGVLKQ
LSESATRRVGDIDWLSDVEQQQLETWSVNDEHYEWEAPIHRLIERRSDMAPGATALIFDD
QHLSYAELNTRANRLAHYLIGLGVQPETRVGIAVERSIEMVVGLLSILKAGGAYVPLDPD
YPSERLAYMVEDSGIELLLTQQHLRNTLPVFESLGVIELDQLDVAHHASTNPEVALHGEH
LAYVIYTSGSTGRPKGAANRHHALTNRLQWMQDAYGLTTDGAVLQKTPFSFDVSVWEFFW
PLIQGARLVMAPPGAHREPAQLVELIRSHNITTLHFVPSMLQAFLAHGKVEDCTSLTRLV
CSGEALPAELQNQVFARLPHTELYNLYGPTEAAIDVTHWACQDDGRNHVAIGQPIAGIRT
YVLDGDLNLAPPGVAGELYLGGIGLARGYLHRPDLTAERFVADPFAQGECLYRTGDLVRW
REDGQLEYLGRLDHQVKIRGLRIELGEIEAELLSQPAVREAVVVAQEGPGGSRLVAYVVL
QADSKLDTSSLREALGQRLPDYMVPGVVVTLDTLPLNPNGKVDRKALPEPDLTSGTRYEL
PQGQSEETLAAIWAEVLGVERVGRHDNFFELGGHSLLAMQVLARIRAAGLHSLALRELFK
SPVLCELAPLISTGMNDMAGGEPLTSIPRREEMPLSPAQKRLWMVDRLAGSTRERTAYNM
STALTLTGRLDAEAIKSTFDVIVDRHEVLRTRYPENEEGEPVAVVASGNPMEVEWVDLVN
LESNQQSQQARWLMEEHAQRAFDLSSGPLLRAAVIRLAPRSHLLLLCVHHIVFDGWSEAV
FIKEFVTTYQALIGEGEDVLTDLPIQYVDYAAWHEKALSGEAFEQSATFWRRYLSDAPPL
STLPGDFARPSQISHAGSALSMTLSPDLSQALNKLAAQRGTTLFTLLLASFQLLMHRQTR
QHDLIVGTDVAGRSHPDVEPLIGFFVNVIPLRSRLSDGQIDFGHWLEQVQTSVLDAFDHQ
NVPFDKIVELSGIGRERDRSPLIQTLFVLQNTPTERFSIPGLEVEVMPQPRQESKFDMAI
FVNESDTGLSVEWVYATALYRRETIEHLTGAWQSLLAQIVEAPNTPVEEFRLPQMEKHAM
QNKLSKGSKLNKLSSLKSQPGARPSTNSDSPIRTALLDEKRVFPLVIEATDPDLDAVAWA
TSQRDFIEQHLRTHAGILFRNFGLTTPQEFEAFAEAIQPGLYGNYGDLPKKEGGRNTYRS
TPYPERQMILYHNESSHLERWPRKQLFFCEFPSPVGGATPIVDCREMLRQLPADVVEEFE
RKGLLYVRTFTRNLDVSWQDFFKTDSKEEVEARLKEAGIEWQWFGDDELQTRTRCPAVVT
HPVTGDRVFFNQVQLHHVSCLEPDVKEDLLGMVGQERLPRNVYFGDGSVISDEMMKVVGE
AYEACAVRFDWRRGDVVMVDNMLAAHARDPYEGPRKIVVAMGDIYERSALEEAQGASADA
ELVGQ
NT seq 12258 nt NT seq  +upstreamnt  +downstreamnt
atgaatataaggcacgcccagacgatgaacagccacccgtcccataacgttgttaaccac
agcttcgttgagcatttaagtcgcctggcccgggaaaggcccagcgacagggcgctgatt
gtagtgaacgcacaaggtgagaccacccttgactacgccaccctggagcggcgttcccgc
gccctggccagcgagctccagcagcggttcccggctggtgagcgtgccttgatcctgctg
gataacgatgaacactatgtggtggcgttcttcgcctgcctatatgccggggtgattgcc
gtgccggtcttccctccagagtcggccaagcagcaacatctggcacgtctgctcgccatt
gccgccgactcccaggccgcctgtgtgctcacctctacaacgattatcgatgtggtcgca
tctgcaagcgaaggcttcggcagcgccgaactgatccccgtggatgccgtagatgagagc
cgcgctgaacactggattgagcatcgcccaaagcgtggtgatctcgcctttttacagtac
acctcaggttccacggccactcccaaaggggtgatggttagccatgggaacctgatggcg
aacgagcgtgctattgagacgggcttctcgattggtgccgacgatgttttcgtcagttgg
ctgccgctttaccacgacatggggctgatcggtggcctgctgcagcccatctatcgcggt
atccctgcggtattgatgagccccactttctttttacagcggccggtacgctggctggaa
gcgatctcccgccaccggggcaccattagtggtggccccgatttcgcctatcgactgtgt
cttgagcgtatccgtgacgagcagcttgaggcgctcgacttatctagctggcgggtcgcg
ttctcaggcgccgagccggtacgccacgataccctcacgggctttatcgaacgcttccgc
ccagcgggctttgccgctgataccgcagcaccctgttatggcttggccgaagcaacgcta
ttggttagctgtaattcgcgcggtacgggcgtggtgggtactgctttttctcaacaatcg
ctggccgagggaaaggctgtttcagcggttgaaggcaacaccctggtgggctgcggtaca
ccggaacccggtcacgctatcgatattgtcgaccctgaggggcttcactcgctgcccagt
ggtgacgtcggcgagatctgggtcaatgggcccagcgtggcgcacgggtattggcagaac
ccagaagcaacagcgcaagcctttgtcacccgcgatggggtcagttggcagcgcaccgat
gatgctgatgcacagaaccacgacgcccgcgatgatcgatggctgcgcactggcgatcta
ggctttctgcacgaagggcagctgtatatcgccgggcgtattaaggacctgatcattctg
cgcggccataacgtctaccctcaggatatcgagagcgctatcgaggcggaagtggaagca
gtgcgcaaagggcgcgtggcagcctttgcagtgaccacccctgaaggcgccgaggggatt
ggcgtcgcggcagaggtctcccgcggcatacagaagctagtgcccgccgagaagctggtc
gaagcactaagcgagacggtgggatccgcttgccacgagccgctttcggtagtgctactg
cttaacccaggcggtcttcccaaaacctccagcggtaaattgcagcgcagcacctgccgc
caaggctgggaggcgggkagcctggatgcctacgccattcacgcctttgggcgttttgtc
agtgatggtgacgctgagggcggaggaaagtcatcgccatcgcctgcggaagctgggagc
gaaacggagcaggcgttggcgaagctctggcaccaggtgctgggggatgacgacacccag
tcgcaaagtaagccgctaggcagcgatgctcatttcttcgccagcggtggtaattctctg
gcggcggtgcggctagccgccaccatcagtgattactggggcgtcgagctatctctgcac
tcgctgttcgagcaaccgcgcttgtctgccatggctaaagctatcgaagcacgtttggcg
gcatcatcggatcaacgagggatggccatcccccgtcttgaagatgatcagcgccaaggc
gacataccgctgtcggaaggacagcgcagcctatggctgacgtggcaacttgatccccag
agcgctggttacaatatggcaggggcactgcatctcaagggggtgttggatccatcatcg
ctcaatgcagcgctggaggatctcgtgcaacgccatgacattttgcgtacttactacccc
ttgagtgaggcgggagaacctgttcagcggctagcgcaggattggcatcctgagttgatc
tgtgacgagatgcccggtgataccgtggatgaacgggagcaggcactgcatgacgcactc
accaaactggcccggaaggcttttgccctggatcaggcacctcccttaaccatcgcactc
taccgcttgtccacggagcaccatgtgttagctgtcgtgcagcaccacattgctggcgat
ggatggtcagtgcaggtgctcatcgatgatctatgcgcactttatgagggtgcgtgcaca
cagcaagaagtcaagcttgcaccactgccagtacagttcgcagattatgcggtttggcag
cagcgtcagaagcacagtagtgagcgacatagtagtgagcggcagggccaacttgctcac
tggtgtgaacgcctctcgggggatcatcccccgctagcgttgcccttggatcgcccacgc
caagcgatgtccgcaccgagcgaaggccaactgcgctttacgcttcccggtgagttgagc
gagcagctacgtagcctagcccgtgaaagaaacgtttcactctacgccgtgatcttggcg
ctattgaagcagacgttgtatcgctttagcggtgagacagatatcaaggtaggggcgccg
attgccaatcggcataaagccgagcttcagggcttaattgggtaccttatcaatgtcgtt
gtgttgcgcactcagattgatcccactggaaatttcgaacgtttgttagatgaggtgaac
gctaccctgatcgatgcccagctgcatcaggatgtccccttcgatcaagtggtggaggcg
ctacagctagaacggcaaccgggggtacatccgctatttcaggtgaagtgtactcagcag
gaaatgtggcaggcggagcgtcacgtggctggcctagtcattcaagccgagcaggtattc
acgggtattgctcacttcgacctgagtctcgatttttgcgatgagcccgagggaatagca
ggtctattcgcttactccgcagagctattcgatgccaccacgatcgagcgtttctgccag
gcattccgattcctggccgagcaggtcgtagctgatccgcggtctcacactgcgatgctg
tcgctacctgagcctatctccgtgttggaaggaaaccaaagcgagattctcactcaggct
atacccaccctgctgtcgaaagtggtggtagctcatgctgatgagttagccgtaaacgac
gggcagtaccgttatacctatgccagcctggatgcccaagcccagagtctggcacaggca
ctaatcgcaaaaggcgttggttccgaggtgcgtgttgccattcacgccgagcgttcgtgc
gagtacgtgctcggtatcctcgccgtactcaaagcgggcggggctttcgtaccgctggat
ccgcaactgccgcgcgagcgcttggcctatcaattggctgacagtggcgctcgcttgatg
ctgagcagtacggcttgcgactggagcgatgctgttccggtaatggagctggcgtttkcc
gacgatgttccggctgccgtagagaataaatcccccgtcatccatcttcagcagactgcc
tatgtgatctatacctctggttccacgggcaagcctaaaggggtggcggttagtcacggt
gctctggccaattacgtacagggtgttctggaggcgctggcgctaccagaaggtgcccgc
aacatggcgatggtgtcgacggtggcggcggatctggggcatacggtgctgtttggtgcc
ttgtgcaccggccgcaccttgcacctcatttctcccgagtgcgcctttgacccggatgcc
tttgcagcttatatgcgggaacagcgggtggatgtgctcaagattgtgcccagccacctg
cgggcactgctgagtgcggcaaccccggctgacgtgcttccgcacgagcgcctgattctg
ggcggcgaagcgaccgactgggcgctactggaacgtatcgccgagcttaagccaacctgc
caagtgcttaatcactacgggcctacggaaaccacggtaggtattctcacccagcaagct
gacatagccgatcgagctgccagcacactgcctatcggcacaccgctggccaatgctcag
gcctgggtgctggatccctggcttaatccggtaccgaagggtgttgccggcgagctctac
ttgggtggcccaggactggctcaaggctatctacagcggctggggcaaacggcggaacgt
ttcgtcgccagccccttccatgcgggggagcggctctatcgcagcggtgaccgtgtgcgc
caactggccgacggtagcttgacgtttctttgccgtgtggatgatcaggtcaagattcgc
ggctatcgggttgaaccgagcgaaatcgctaccctgctgcgcgatcaaccgtgcatcgcg
gaggccgaagtggtagcgcgggaaaacgaggaaggccgtgcgcaactgttcgcctacgtg
gttatggcagccggaagcgacatcgatgacgccgcgttactcgcgcagcttggcgaacgc
gtgccggactatatggtgcccagtgccatagtacggctagatgccttaccgctaaccgcc
aatggcaagttagatcgmaaggcgctgcccgagccagtacaagcgggtggtggtaaagca
ttcgaagctccccagggagcagcggaggaaaccctagccgcagtctgggccgacgtaatc
ggctgcgagcaggtggggcgcaacgacaacttcttcgagctgggtggtgactcaatcctc
agtctgcaaatcgtcgcgcgttcgcgtaaacgtggctacaaggtaacgcctaagcagttg
atggaagggcagactgtggccgccgtggcggcgatggccacgcctctagctgctaccgct
cctaaacaagcggctgcgcccaataaagcagcttcctttgcgctgctgccggtacagcgc
tggttcttcgagcagaactttgccgagccacagcactggaatcagtcgttgatgctggaa
gcggccagtggtgtagataccgcgctgctacggcgtgccattgaggcagtggtagatcac
catagcgccttgcggctgcgctttgagcgcgttggcgatagctggcaacaagcctatggc
aagctagccgacgatctcttcgagcacgtggacgtaagcgatcatgcggatccggcgcag
gccatcacccaggctgccgatgctgcgcaacgcagtctgagtttggcgcggccgttccgt
gctatctggatggcactgggaggcgagcgcggagggcgattgctgctagtggctcaccac
ctggtgatagacggcgtctcgtggcgcgtgatcctcgacgacctgcaagcggcctacgcg
cagttaagtgcaggaaagacagtcgacctaccaccggcaaccaccttgctagatgagtgg
gcgcgtgccctggccgactatgccaaatcggaggctttggctgagcaatgctcctattgg
gaaagtctcgtcacagcgccagagcccagcctaccggcacggaatccccatggcagcaac
accgtcgccgataccgcatcgctcgttggcagcttgcctaccgaggccaccacgcaactg
ctggggccggtgcataaagcctatcgtacccaggtagatgacctgctcctcaatgcacta
tcgagcgccctgtgccaatgggcggagcgagacagtgtactaatcgaactggaaggccat
ggccgcgaagacctgttcgacggtatcgatctcagtcgcagcgtaggttggttcacctcg
ctctacccggttcgcctgaccccaggtaatgcggagcccggtacaagcctaaaagcaatc
aaagagcaacttcgccaagtgcctgaaaaggggctcggctacggcgtgctgcgctatttg
aaagaagagcccgcgctggtcggtggtgcctacccccaggtcaccttcaattatctaggc
cagttggatcgctccctacagggcgatggggcctggcggctcgctaaagagaatgcaggg
caggctcgcgcgccccaaagcaagcgccgtacctggattgaggtggtggcctgggttcaa
gatggccaactgcgcttcgactggaattacagtcgtgagattcacagcgaggcagcgata
catgccttgcaagtaagcttccaagcgcaactagaggcattgattgagcactgtgctagt
ggcgttcgtggcgcaacaccttcggacttcccgctggcggggctgagtcaagagcagctt
gacggcttgcctgttgacactgmccagctggcggatctctacccactgtccccgttgcag
cagggcatgctgttccacagcctttacgatgaccaagattcagcctatctgaaccagttg
caggtagaaattgacgacctggatgtcaaacgcttccagctcgcttggcaagcagtactc
gcgcgccatgaggttctgcgcagtggcttcctggagagtgctggaatgccgttgcagtgg
gtggcgcgcaacgttgatctgccgtggtttgaagtggattggcgcgaacgagtggatcta
aaagcggcgcttgagagactgtcccaggagcagcggaaaccgttcgacatgacggcgccg
ccgctgatgcgcttggcgttggtgcgaattgcagaaacccgatactgctttatctggacg
cgccaccatttgctgctggatggctggagtacgtcgcaactgatgggcgaggtgttgcgc
tgttacgccggagaggccttgccatctgcagaaggacgctatcgtgattacattgcatgg
ttacagcgtcgtgacaccaatgccagtgagacttactggcgtgaccagctgcagcgtctc
gatgcacccacgcacctagtgagcaccmcccctagaccttacgaggcgcaagctgggcat
caagagataaccctgtcactggatagcacgaccactcaacgattggagggtttcgccaaa
gcgactcgcataacgctcaatactttaatgcaaggtgcctgggcgctgctggtggcacgt
tatacggggcaagatagcatctgttttggagctaccgtggctggacgacccgctgagcta
ccggcagcagaaaacttgatcggcccctttattaataccttgccagtcattgtttcattg
aacccctcgcttcgcgtcaacgagtggttgtgccagttacaggcacaaaacttggcgagt
cgcgagcatgagcatacgccgctatacgaaatccaacgctgggcggggcagggtggccag
gcactgttcgatagcttggtggtattcgagaactatcccgttgatgccgcgttacaccag
aatttgccaggcgggctgacgttcggcgaagtggataaccgcgagcaaaccaattatccc
gtcacgctggtcgtcttccataaggaggcgttggagctttgctgcggctattcacggtca
cagttagatgatgccgctgccgagatattgatccagcatctggtgggagtgctgaaacag
ttgagtgagtcggctactcgccgagtcggtgacattgactggttaagtgacgttgagcag
caacagcttgagacgtggagcgtcaatgatgagcattacgaatgggaagccccgatccat
cgtttgattgagcgtcgttccgatatggcgcctggagctacagccctcattttcgatgat
cagcatctcagctacgccgagcttaacacccgggccaatcgcttggcccactatctgatt
ggtttaggcgtacaacctgagactcgagtaggcatcgctgttgagcgctccatcgagatg
gtggtggggctgctgagcattcttaaagcggggggcgcctatgtaccgttggatccggat
taccccagcgaacgtctggcctatatggttgaagacagcggtattgagctactgcttacc
caacagcaccttcgcaatacgttgccggtgtttgagagccttggcgttatcgagctggat
caattggacgtggcgcatcatgcgtcaaccaacccggaggtggcactgcacggtgaacat
ctcgcttatgtcatttacacctcgggttctaccgggcgtcctaagggtgcggccaaccgt
catcacgcgctgaccaaccgcctgcagtggatgcaagacgcctatgggctgacgaccgac
ggtgcggtgctgcagaaaacgccattcagtttcgatgtttccgtgtgggagttcttctgg
ccgctgatacagggggcgcggctggtgatggcgccgccgggagcccatcgcgaaccggca
caattggtcgagctaatccgtagccataacatcactacactgcactttgtaccttcaatg
cttcaggccttcttggctcatggcaaggttgaagactgcaccagtctgacacgcttggta
tgcagcggtgaggcgctgccggccgaactgcagaatcaggtatttgcccgcttgcctcat
acggagctctacaacctatacggccccaccgaagcggccattgatgtcactcactgggcc
tgccaagacgatgggcgcaaccacgtagctatcggtcaacccatcgccggtatccgcacc
tatgtgctggatggagatcttaacttagcgccaccgggagttgcgggggagctctatctc
ggaggcattgggttggcacggggctatctgcaccgccctgaccttaccgcagaacgtttt
gtcgccgatccatttgcgcagggcgaatgtctctaccgcaccggcgacctagtgcgctgg
cgggaggacggccagcttgagtacctgggccgcctcgatcaccaagtgaagatccgcggc
ctgcgtatcgagcttggcgagattgaagccgaactactctctcagccggcggttcgtgaa
gcggtggtggtcgctcaagaaggccccggtggttcgaggctggtggcctatgtggtgctc
caggccgacagtaaactcgacactagttcactgcgtgaggcgctggggcagagactgccg
gactatatggtgccgggagtcgtggtcacgctcgatacgttaccactgaaccccaacggc
aaggtggatcgtaaggccctgcctgagcctgacttgaccagtggcacacggtacgagctt
ccccaggggcagtcggaagaaacgctagcggcaatctgggctgaggttttgggtgttgag
cgggtcggccgccacgacaacttttttgagctaggcggtcattctctgttggcaatgcag
gtgcttgcacgcatacgagcggcaggcctgcatagcttggctcttcgtgaattatttaag
tccccggttctgtgcgaattggccccccttatctctaccggtatgaatgacatggctggt
ggagagccactaacttccatccctcggcgtgaggaaatgccattgtccccggcccaaaag
cggctatggatggttgatcggctggcaggctctacccgcgagcgaactgcctacaatatg
tccactgctctaaccctcacagggaggcttgatgcagaagcgattaagtcaacgtttgac
gtaattgtagatcgccatgaagtactgcgtacccgttaccctgagaacgaagaaggkgaa
ccggttgcggtcgtcgcatccggcaaccctatggaggttgaatgggtcgacttggttaac
ctggagagcaaccagcagagtcagcaagcccggtggcttatggaggagcatgcccagcgc
gcatttgatctctcctcggggccgcttctccgtgccgccgtaattaggttggcaccacgg
tcgcatctgctgctgctctgtgttcaccacattgtatttgatggttggtcagaagctgtc
ttcatcaaggagttcgtcactacctatcaggcgcttatcggagaaggtgaagatgtgttg
accgatctccccatccagtacgtggactacgccgcttggcatgagaaagcattgtcggga
gaggccttcgagcaaagtgcaaccttctggcgtcgctatctaagtgatgctcccccgctc
tcaacactaccgggggatttcgctaggcccagccaaatatcgcatgccggtagtgccctg
agcatgacactgagtccagacctatcacaagcgttgaacaagcttgccgcacagcgtggc
accacgctatttacgcttctattggcgagttttcagctgttgatgcatcgccagacccgt
caacacgacctgattgtgggaaccgatgtcgctggccgtagccatcccgatgttgagccg
ttgattggcttttttgtcaatgtaatcccgctgcggtctcgtttgtctgatggccagatt
gatttcggccactggcttgagcaagtacagaccagcgtgctggatgccttcgatcatcaa
aatgttcccttcgacaaaattgtcgagctttcggggattggtcgtgagcgcgaccgttcc
cccctgatacaaaccctcttcgtactacaaaacacgccaaccgagcggttctcaattccg
ggcttggaagtggaggtaatgcctcagcctcggcaagagtcgaagttcgatatggcgata
ttcgtcaatgagagtgacaccggactatcagtcgagtgggtctacgccaccgcattgtac
cgacgcgaaaccattgagcacttaaccggtgcctggcagtcgctactagcgcagatcgtg
gaagctcccaacacgcccgtcgaggagtttcgcttaccccaaatggagaaacacgctatg
caaaacaagctttcaaaaggttccaaactcaacaagcttagcagcctgaaatcccagcca
ggtgcgcgcccctcgaccaacagtgactcaccgatacgaacggcgctgctcgacgaaaaa
agggtctttcctctcgtgatcgaagcgacggatcctgaccttgatgcggtggcgtgggca
acctcccagcgcgactttattgagcaacacttacgcacgcatgcaggcattctgttccgt
aactttggtctgaccacaccgcaagagtttgaagcctttgccgaggctatccagccggga
ctttacggcaattatggtgacctgcccaagaaagaaggggggcgcaatacctaccgttca
accccctatcccgagcgccagatgattctttatcacaacgaaagctcgcatttggagcgc
tggccgcgcaagcaactgttcttttgcgaattcccttctcccgtgggaggtgccaccccg
atcgttgactgcagggagatgttgcgccaactgcccgccgatgttgtggaggagttcgag
cgtaaagggctgctttatgtgcgcaccttcacccgcaacctggacgtgagctggcaagac
tttttcaaaaccgatagcaaggaggaagtggaggcgcggctcaaagaagcgggaatcgag
tggcagtggtttggggacgatgagctgcagacacgcacgcgctgccctgcggtagtcact
catccagtgaccggtgaccgggtgttcttcaatcaggtgcagctccaccacgtcagttgc
cttgagcctgatgtgaaagaagacctgcttggcatggttggccaggagcgcctgccgcgt
aatgtctatttcggcgacggctccgtgattagcgacgagatgatgaaggttgtcggcgag
gcctacgaagcctgtgccgtgcgcttcgactggcgccggggcgatgtggtgatggtcgac
aacatgttagcggcccatgcccgggatccttacgaggggccacgcaagatcgtggtagcg
atgggagacatctatgagcgttcggcgctggaagaggctcaaggagcaagtgccgatgcc
gagttggtcggtcaatga

DBGET integrated database retrieval system