KEGG   Helianthus annuus (common sunflower): 110886145Help
Entry
110886145         CDS       T05101                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain clone 512-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
han  Helianthus annuus (common sunflower)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110886145
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110886145
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110886145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 169 aa AA seqDB search
MSSATFTAPVTGSIYMGLNPNGSKLFRTTDSAPWSRKTVSNGSRIHCMKVWNPINNKKFE
TLSYLPPLTDESIAKEIDYMIKKGWVPCLEFDLVGHVFRENSQIPNYYDGRYWTLWKLPM
FGCNDSSQVLNEIQECKKTYPNAYIRCLAFDNVRQAQCMSFVIQKPTDP
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagcaacattcacagctccagttaccggatccatttacatgggtttgaatccc
aatggatctaagctttttcggaccacagattcggcaccttggagccgaaaaacagtttcg
aatggctctaggattcactgcatgaaggtttggaatccgataaataacaagaagtttgag
actctttcgtatcttccgcctcttacagatgaatccatcgcaaaggagattgattacatg
atcaagaaaggatgggtgccgtgtcttgagtttgatttggtgggacatgtattcagagaa
aacagccaaattccaaattactatgatggaaggtattggacactatggaaactgcccatg
tttggctgcaatgattcctcacaggtattgaatgaaattcaggaatgcaaaaagacatac
ccaaatgcatatatcaggtgtttggcatttgacaatgtgaggcaggctcagtgcatgtct
tttgttattcagaaaccaactgacccatga

DBGET integrated database retrieval system