KEGG   Helianthus annuus (common sunflower): 110917772Help
Entry
110917772         CDS       T05101                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain 4, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
han  Helianthus annuus (common sunflower)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:han00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    110917772
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    110917772
Enzymes [BR:han01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     110917772
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
AA seq 178 aa AA seqDB search
MASLSSPTMATAAVPTQATMVAPFTGLRSTAAFPSTKKAENDFSSLPSNGGRVQCMKVWP
PLGLKKYETLSYLPTLTEAQLAKEVDYLLRNKWVPCLEFELEHGFVYRENHRSPGYYDGR
YWTMWKLPMFGCTDSAQVLKELNECKKEYPSAWIRIIGFDNVRQVQCISFIASKPDGF
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactttcctcacccaccatggccaccgcagccgtcccaactcaagccaccatg
gtggctcccttcaccggacttaggtccactgcggctttccctagcaccaaaaaggctgaa
aacgacttctcttccctccccagcaatggtggaagagtgcaatgcatgaaggtgtggccg
ccactcggattgaagaaatacgagactctttcataccttccaactctaactgaggcccag
ttggctaaggaagtcgactaccttctccgcaacaagtgggttccttgtttggaatttgag
ttggaacacgggtttgtctaccgtgagaaccatagatcgccagggtactatgatggcaga
tactggacaatgtggaagttgcccatgtttgggtgcactgattccgcccaggtgctaaaa
gagctaaacgagtgcaagaaggagtacccaagcgcatggatccgtatcattggatttgac
aacgtccgtcaagtccaatgtatcagtttcatcgcatctaagccagatggattctaa

DBGET integrated database retrieval system