KEGG   Halothece sp. PCC 7418: PCC7418_3855Help
Entry
PCC7418_3855      CDS       T02379                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
hao  Halothece sp. PCC 7418
Pathway
hao00620  Pyruvate metabolism
hao00680  Methane metabolism
hao00710  Carbon fixation in photosynthetic organisms
hao01100  Metabolic pathways
hao01120  Microbial metabolism in diverse environments
hao01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hao00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC7418_3855
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC7418_3855
   00680 Methane metabolism
    PCC7418_3855
Enzymes [BR:hao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCC7418_3855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 YfiO
Motif
Other DBs
NCBI-ProteinID: AFZ45959
UniProt: K9YGH5
LinkDB All DBs
Position
4169144..4172185
Genome map
AA seq 1013 aa AA seqDB search
MTSLLQAFSQDTNNSSRSDTFLTDRIKLIEDLWESVLRAECGQELVDLLQQLRSMGSPEG
QATGLPTSSVPQLIEDLPLNDAVRAARAFALYFQLINIVEQHYEQREQQLNRYFSHDKTE
KDLAEGNIKGQQTETDASHSVLGAQLLEKTWQGNSTYQKAGTFDWLFPYLKKLNVPPQLI
QRLLNQLDIRLVFTAHPTEIVRHTIRKKQRRMSQILQHIDQSEIAAQSLGFLESPEAIAA
TEQLKEEIRLWWRTDELHQFKPEVLDEVDYALHYFQEVLFDTIPHLSSRLKQSLNSSFKD
LNPPQNNFCRFGSWVGADRDGNPSVTPTVTWETACYQRGIVLERYLQSVKRLSTLLSLSL
HWSDVLPELLESLERDRALMPDVYERLSIRYRREPYRLKLAYIEQRLEHTLQRNHFLSSE
QQAPRETIEKNRQTIYTFGEEFLEELKLIQRSLTETGLTCRDLEHLICQVEIYGFNLVEL
DMRQESSRHSDTVTEITDYLQLLPQSYNDLSEEERVRWLSEELQTRRPLIPKELPFSEKT
KETVETFRLLKQLQQEFGCEVCQTYIISMSHHVSDILEVLLLAKEAGIYDPATGKCSLQV
VPLFETVDDLLRAPSVMKALFELPLYRACLAGGYGQENSDEYDIQEVMLGYSDSNKDSGF
LSSNWEIHKAQKALQTLAQGYGVSLRIFHGRGGSVGRGGGPTYEAILAQPSSTINGRIKI
TEQGEVVASKYSLPELALYHLETATTAVIQASILGSGFDDINPWQNIMERLAARSRQHYR
ALIYEEPDFLDFFLSVTPIQEISQLQISSRPARRQGGKKDLSSLRAIPWVFSWTQTRFLL
PAWYGVGTALQDFLYQDQERSCEQNTKLLRYFYWKWPFFRMVISKVEMTLAKVDLQIAHH
YLKELANPEDYERFERIFQQISDEYHLTSELVRLITNHEKLLDGDPDLQRSVQLRNRTIV
PLGFLQVSLIKRLRQYSNESASEVIHFRYSKEELLRGALLTLNGIAAGMRNTG
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgacttctctgttgcaagcattcagccaagacactaacaactcctcccgttctgataca
tttctcacggatcggattaagttgattgaagatttatgggaatcggtgttgagagcggag
tgtggtcaggaattagtcgatctattgcaacagttacgatctatgggatcaccagaggga
caggcaacgggattaccaacttcttctgtcccccaactgattgaagatcttcccctcaat
gatgcggtacgagcagcccgtgcttttgccctctattttcagttgattaatattgttgaa
cagcactacgaacaacgagagcaacaactgaatcgctatttcagccacgataaaaccgaa
aaagaccttgcagaaggaaacatcaaaggacagcagaccgaaactgatgcttctcacagt
gttctcggtgcacaactgctagaaaagacctggcaaggtaattccacttatcagaaagcg
ggaacgtttgactggctctttccttacttaaaaaaattgaatgttcccccacaactgatt
caacgcttactgaatcagcttgatattcgattggtcttcacggctcatccgaccgaaatc
gttcgccacacgattcggaaaaaacaacggcggatgtctcagattttgcaacatattgac
caatccgaaattgctgctcaaagtttgggctttctggaatctcccgaagcgattgcagcc
acggaacagttgaaggaagagatccgtttgtggtggcgcactgacgaactccatcagttt
aagccagaagtcctcgatgaagtggattatgctttgcactatttccaagaagttttattt
gatacgatccctcatttatcaagtcgtctgaaacaatccctaaatagttcttttaaggat
ttaaatcctccccaaaataatttctgtcgctttggctcttgggtgggagccgatcgcgat
ggcaatccttctgtaacgccgacggtgacttgggaaaccgcttgttatcaacgaggaatt
gttctagaacggtatttacagtcggtgaaacgattaagcactctgttgagcctgtcttta
cattggagtgatgttttaccagaattattagaatctctggagcgcgatcgcgcattgatg
ccagatgtttacgaacggttatccattcgctatcgtcgagagccctatcgtctcaaactt
gcctacatcgaacaacggctagaacatacgctccagcgcaatcatttcttatcttccgaa
caacaagccccgcgagagaccattgaaaagaatcgtcaaacaatctacacctttggcgaa
gagttcttagaagaattaaaactaattcaacggagtttaaccgaaactggactcacttgt
cgcgatctcgaacatttaatctgtcaagtggaaatttacggcttcaacttagttgaactg
gatatgcgccaagagtcttctcgccattcagatacagttaccgagattacagattactta
caactactgcctcaatcttataatgatttatcagaagaagaacgagtacgatggctgagt
gaggaattacaaacccgtcgccccctgattccaaaagaacttcccttttctgaaaaaacc
aaagaaaccgttgaaaccttccgcctcttaaaacaactgcaacaagagtttggctgcgaa
gtttgccagacttacattatcagcatgagtcatcatgtgagtgacattttagaagtgtta
ctcctcgccaaagaagcaggaatttatgatccagcgacggggaaatgtagtttgcaagtg
gttcccctgtttgaaaccgttgatgacttgctcagagccccttcagtcatgaaagcctta
tttgagttgcccttgtatcgcgcttgtctcgcaggaggctatggtcaagaaaatagcgac
gagtacgatattcaggaagtcatgctcggttattctgatagtaataaagattcaggcttc
ttaagcagcaattgggaaattcataaggctcaaaaagctctgcaaactcttgctcaagga
tacggggtttctttgcggattttccatggtcgcggtggctctgtgggacgagggggagga
ccgacttatgaggcgattttagcccaacccagttcaaccattaatggacggattaaaatt
accgaacaaggagaagtcgttgcctccaaatactcccttcctgagttagctctctatcac
cttgaaacggcaaccacagccgtgattcaagcgagtatattaggaagtggctttgatgat
attaatccctggcagaatatcatggaacgccttgctgcgcgatcgcgccagcattaccgc
gccttaatttacgaagaacccgattttctcgactttttcctgtccgttactcccatccaa
gaaattagccaactgcaaattagttctcgtcccgcccgtcgtcaagggggtaaaaaagac
ttaagctccctgcgtgcgattccttgggtctttagctggacacaaacccgtttcctactt
ccagcttggtatggggtgggaaccgccctccaagactttttatatcaagatcaagaaaga
agctgtgagcaaaatacgaagctcctccgttacttctactggaaatggccctttttccgc
atggtgatttccaaagtagaaatgaccttagcgaaagtggatctgcaaattgcccatcat
tatctcaaagaactggcgaaccctgaagactatgaacgctttgaacggatttttcaacaa
atttctgatgagtatcatctcaccagcgaattagtccgtttaattaccaaccacgagaag
ttgcttgacggcgatccagacttacaacgttctgtccaactgcgaaatcggaccattgtc
cccttagggtttttacaagtgtcgctcattaaacgcctgcgccagtatagcaacgaaagt
gcttctgaggtcatccacttccgctacagcaaggaagaattgctgcggggagcgttatta
accctgaatggcattgcagcaggaatgcggaatacaggttaa

DBGET integrated database retrieval system