KEGG   Herminiimonas arsenicoxydans: HEAR2498Help
Entry
HEAR2498          CDS       T00490                                 

Gene name
sodB
Definition
(GenBank) Superoxide dismutase [Fe]
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
har  Herminiimonas arsenicoxydans
Brite
Enzymes [BR:har01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     HEAR2498 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2470640..2471218
Genome map
AA seq 192 aa AA seqDB search
MEHTLPALPYALDALAPHISKETLEFHYGKHHQTYVTNLNNLIKGTEFENASLEDIIKKS
SGGVFNNAAQVWNHTFYWNGMKPNGGGAPTGKVADAINAKWGSFDKFKEEFTKSCVTNFG
SGWTWLVKKADGSLDLANTSNAGCPLTGTDTPLLTCDVWEHAYYIDYRNARPKYVESFWA
LVNWDFVAKNLG
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggaacataccctgccggcactgccctatgcgttggatgcacttgctccacatatctcc
aaagagacgctcgaattccactatggcaagcatcatcagacctatgtgacgaatttgaac
aacctgatcaagggtaccgaattcgaaaatgcatcgctcgaagacatcatcaagaaatct
tccggcggcgtattcaacaatgcagcacaagtctggaaccataccttctactggaacggc
atgaagccaaacggcggcggcgctccaaccggcaaggtagctgacgctatcaacgccaaa
tggggttccttcgacaagttcaaggaagaattcaccaagtcctgcgtcaccaacttcggc
tccggctggacctggctggtgaaaaaagccgacggctcgctcgatctggccaatacttca
aacgccggctgcccattgactggcaccgacaccccattgctgacctgcgacgtgtgggaa
cacgcttactacatcgactaccgcaatgcgcgtccgaagtatgttgagtcgttctgggcg
ctggtgaactgggatttcgttgcgaaaaacctgggctaa

DBGET integrated database retrieval system