KEGG   Herminiimonas arsenicoxydans: HEAR3168Help
Entry
HEAR3168          CDS       T00490                                 

Gene name
tufB1
Definition
(GenBank) Elongation factor Tu-B (EF-Tu-B)
  KO
K02358  
elongation factor Tu
Organism
har  Herminiimonas arsenicoxydans
Brite
Translation factors [BR:har03012]
 Eukaryotic Type
  Elongation factors
   HEAR3168 (tufB1)
 Prokaryotic Type
   HEAR3168 (tufB1)
Mitochondrial biogenesis [BR:har03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    HEAR3168 (tufB1)
Exosome [BR:har04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   HEAR3168 (tufB1)
  Exosomal proteins of breast cancer cells
   HEAR3168 (tufB1)
  Exosomal proteins of colorectal cancer cells
   HEAR3168 (tufB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3119135..3120325)
Genome map
AA seq 396 aa AA seqDB search
MAKGKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSKKFGGEAKGYDQIDNAPEEKARG
ITINTSHVEYETTTRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYEFPGDDLPIIKGSAKLALE
GDQGPLGEAAILALADALDSYIPTPERAVDGAFLLPVEDVFSISGRGTVVTGRIERGIVK
VGESLEIVGIRDTQVTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLAKPGS
IKPHKHFTGEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVMLINPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcgagcggaccaagccgcacgttaacgtcggtacaattggtcac
gtcgatcacggcaaaaccacactgacggcagcgattgcgaccgtattgtctaagaaattt
ggtggcgaagccaagggctacgaccaaatcgataacgcgcctgaagaaaaagcgcgcggc
atcaccatcaacacctcgcacgttgaatacgaaaccaccacccgtcactatgcccacgtt
gactgcccaggccacgccgactatgttaaaaacatgatcaccggcgccgcacagatggac
ggcgcgatcctggtttgttccgcagctgacggcccaatgccgcaaacacgtgagcacatc
ctgctggcacgtcaggttggcgttccatacatcatcgtgttcctgaacaagtgcgacatg
gttgacgatgcagaattgctcgaactggtcgaaatggaagtgcgcgagctcctctccaaa
tacgaattcccaggcgacgacctgcctatcatcaaaggttcggccaagttggcactcgaa
ggcgaccaaggtccattgggcgaagccgccattctggccctggctgatgcactcgacagc
tacattccaacaccagaacgcgcagttgacggcgccttcctgttgccagtggaagacgtg
ttctcgatctccggtcgcggcaccgttgtaacgggtcgtatcgaacgcggtatcgtcaaa
gtcggcgaatcgctggaaatcgttggtattcgcgacacccaagtcaccacctgtaccggt
gttgaaatgttccgcaaactgcttgaccaaggtcaggcaggcgacaacgtcggcgtattg
ctgcgtggcaccaagcgtgaagacgtggaacgtggtcaagttctggcgaagccaggttcg
atcaagccgcacaaacatttcacgggtgaaatctacgtattgtcgaaagacgaaggcggc
cgtcacaccccattcttcaacaactaccgtccgcagttctacttccgtactacggacgtg
actggttcgatcgagttgccgaaggataaagaaatggtgatgccgggcgacaacgtctcg
atcacggtgatgttgatcaacccgattgcgatggaagaaggtctgcgcttcgcgattcgc
gaaggcggtcgtaccgtcggtgccggtgttgttgccaagattattgagtaa

DBGET integrated database retrieval system