KEGG   Halanaerobium hydrogeniformans: Halsa_1817Help
Entry
Halsa_1817        CDS       T01349                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
has  Halanaerobium hydrogeniformans
Pathway
has00010  Glycolysis / Gluconeogenesis
has00030  Pentose phosphate pathway
has00051  Fructose and mannose metabolism
has00052  Galactose metabolism
has00680  Methane metabolism
has01100  Metabolic pathways
has01110  Biosynthesis of secondary metabolites
has01120  Microbial metabolism in diverse environments
has01130  Biosynthesis of antibiotics
has01200  Carbon metabolism
has01230  Biosynthesis of amino acids
has03018  RNA degradation
Module
has_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:has00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Halsa_1817
   00030 Pentose phosphate pathway
    Halsa_1817
   00051 Fructose and mannose metabolism
    Halsa_1817
   00052 Galactose metabolism
    Halsa_1817
  Energy metabolism
   00680 Methane metabolism
    Halsa_1817
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Halsa_1817
Enzymes [BR:has01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Halsa_1817
Protein phosphatases and associated proteins [BR:has01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Halsa_1817
Messenger RNA biogenesis [BR:has03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Halsa_1817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADQ15235
UniProt: E4RJ15
LinkDB All DBs
Position
complement(2020809..2021807)
Genome map
AA seq 332 aa AA seqDB search
MNKIAILTSGGDAPGMNPAIRAVARTAIFYNIEVVGVRYGFKGLIEKDFFDMKRSSVADI
IQKGGTVLFSARCEEFRTREGREKAYQNMREEGIDALVVIGGDGSLHGVQKINQESEISA
VGIPATIDNDLSCTDYTIGVDTAMNTILDAINKIRDTATSHERTFVIECMGRDSGYLALM
TGLAGGAEFILVPEIDFTPQEVTNRIVQGFNKGKLHSLILIAEGVKAPFVDLTGYNGSPG
LAMGDLIREKTGMETRVTILGHLQRGGSPTAIDRIIASRMGAKAVDLLIEGHRDIMINYK
DNSIGSCKIADAIVEKQQIDMDIYNLSSILSM
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatagcaatattaacaagtggtggagatgctccaggaatgaaccctgctatt
agagcagttgctagaacagctattttttataacatcgaagtagtaggggtcagatatgga
tttaaaggtttaatagaaaaagatttttttgatatgaagagaagttcagttgcagatata
attcagaaaggaggaactgttcttttttctgctcgctgtgaagaatttagaacaagagaa
ggaagagaaaaagcctatcaaaatatgagagaagaaggaattgatgctcttgtagtaatt
ggtggagatggttctttacacggagtacaaaaaattaatcaagaaagtgagattagtgct
gtgggtattcctgcaactatagataatgacttatcatgtactgattatacaattggtgta
gatacagcaatgaatacaatacttgatgctataaataagataagagatactgctacttct
catgaaagaacatttgtgattgaatgtatgggaagagattcaggatatttagctttaatg
acaggtttagctggaggagcagaatttattttagtaccagaaattgacttcactcctcag
gaggtaacaaatagaatagtacagggatttaataaaggtaaattgcacagccttatttta
atagcggaaggtgtaaaagcaccttttgttgatctgaccggttataatggtagccctggt
cttgcaatgggagatttaattagagaaaaaactggcatggaaacaagagttactatatta
ggccatctgcaaagaggtggtagcccaactgcaattgatagaatcattgccagtcggatg
ggagcaaaagcagttgatctgttaattgaaggtcatagagatattatgataaattataaa
gataattccattggcagttgtaaaattgctgatgctattgtggaaaaacagcaaatagat
atggatatatataatttatctagtatattatccatgtaa

DBGET integrated database retrieval system