KEGG   Halocynthiibacter arcticus: RC74_13750Help
Entry
RC74_13750        CDS       T04275                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
hat  Halocynthiibacter arcticus
Pathway
hat00250  Alanine, aspartate and glutamate metabolism
hat00410  beta-Alanine metabolism
hat00430  Taurine and hypotaurine metabolism
hat00650  Butanoate metabolism
hat01100  Metabolic pathways
hat01110  Biosynthesis of secondary metabolites
hat01120  Microbial metabolism in diverse environments
hat02024  Quorum sensing
Module
hat_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:hat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RC74_13750
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RC74_13750
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RC74_13750
   00430 Taurine and hypotaurine metabolism
    RC74_13750
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    RC74_13750
Enzymes [BR:hat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     RC74_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AML52195
UniProt: A0A126V2N0
LinkDB All DBs
Position
2784341..2785735
Genome map
AA seq 464 aa AA seqDB search
MVDTTKTPAPSNHFDEIYGSDEMSVPLSESIFPGSESDPRNVYASIRDELMLDGNSRQNL
ATFCQTWEEPEIHQLMDDCIDKNMVDKDEYPQTAEIEQRCVRMLADLWNAPSGAATGCST
TGSSEAAMLGGLAMKRRWEARRKAEGKPIDKPNLITGPVQVCWHKFTRYWDVEHREIPME
NGRLLMTPEEVLSLCDENTIGVVPTLGVTFTGQYEPVEAVSAALDKYEAETGLDIPIHVD
GASGGFLAPFCAPELMWDFRLPRVKSINASGHKFGLAPLGVGWIVWRSADDLPENLVFWV
NYLGGNMRDIGLNFSRPGGPITCQYYNFQRLGREGYTKIHKACYATAQYLAAEIGALGPF
DIVYDGDMTSGIPALCWTLKPDVDLGFTLFDLADRLRIYGWQVPAYTLPANCQTQAIQRI
LVRNGVSRDLATLLMRDIRKALAHLTKHPAETPLGENAAGGFHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggtcgataccactaagacgcctgcgccatctaaccatttcgacgaaatttacggctcc
gacgagatgtcggtcccgctttcagagagcatctttcccggaagcgaaagtgacccgcgc
aatgtctatgcgtcgatccgcgacgagttgatgcttgacggcaactcgcgccaaaacctc
gcaacgttctgccagacttgggaagagcctgaaattcaccagctgatggatgattgcatc
gacaaaaacatggtggataaagacgaatatccacagactgcggagatcgagcagcgctgt
gttcgtatgcttgcggacctatggaatgcacccagtggcgcggctacaggctgttccacg
acggggtcgagtgaggcggcgatgctgggtggattggcgatgaagcgccgctgggaagcc
cgccgcaaagccgagggcaagcccatagacaagcccaacctgatcaccggtcccgtgcag
gtttgttggcataaattcacccgctattgggatgtggaacaccgcgaaattccgatggaa
aacggacgccttttgatgacgccagaagaggtgttgagcctgtgtgacgagaacaccatt
ggtgtcgtgcccacgcttggcgtgaccttcacggggcaatacgaacccgttgaggcggtt
tctgcggcgctcgacaagtatgaggctgaaacgggccttgatattccgatccacgttgat
ggcgcttcgggcgggtttcttgcgccgttctgtgctcctgaattgatgtgggatttccgc
ctgccacgggtgaagtcgatcaacgcgtccggacataaatttggcctcgcgccgcttggt
gtgggctggatcgtttggcgcagcgccgacgatcttccggaaaacttggtgttctgggtg
aattatctgggcggaaatatgcgcgatatcgggcttaatttctcgcgtccgggcgggcct
atcacgtgccaatactataatttccaacgacttgggcgggaaggttacaccaaaatccac
aaggcgtgctacgcgaccgcgcaatatctcgcggccgaaattggcgcgcttgggccgttt
gacattgtctacgatggcgatatgacgtctggtatccccgctctgtgttggacgctcaaa
cccgatgttgatcttggatttaccctgttcgatttggccgatcgtctgcggatttatggc
tggcaagtgcccgcatataccttgcctgcaaactgtcagacccaagctattcaacgcatt
ttggtgcgcaacggagtcagtcgcgaccttgctacgctcctgatgcgcgacatccgtaaa
gcgttggcacatttgacaaaacatccggcggaaacaccgcttggcgaaaatgccgccggt
ggttttcatcattga

DBGET integrated database retrieval system