KEGG   Herpetosiphon aurantiacus: Haur_0516Help
Entry
Haur_0516         CDS       T00614                                 

Definition
(GenBank) peptidase S1 and S6 chymotrypsin/Hap
Organism
hau  Herpetosiphon aurantiacus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(598973..600397)
Genome map
AA seq 474 aa AA seqDB search
MERSGRWTIRRVRSAVIATVLSTSVLLGGYAASAKDNKKVEVYPLPVVDEKQPGSEQLPP
PDKIVGGSAATAGEFPWQARIARNGSLHCGGSLIAPQWVLTAAHCVQGFSVSSLSVVMGD
HNWTTNEGTEQSRTIAQAVVHPSYNSSTYDNDIALLKLSSAVTLNSRVAVIPFATSADSA
LYNAGVVSTVTGWGALTEGGSSPNVLYKVQVPVVSTATCNASNAYNGQITGNMVCAGYAA
GGKDSCQGDSGGPFVAQSSGSWKLSGVVSWGDGCARANKYGVYTKVSNYTSWINSYVGTV
TPTSTPVPGTPVPTSTPVPGTPVPTSTPVPGGSLQNGGFESSASWVQSPSNIISTTRPRS
GSYSAFLGGYNSGTDNIYQSVTVPSNGVLRYYWYMSTQESGSTVYDRLYVRLYNSSGSLI
TTLRTWSNASTKNTWTLDTISLSAYAGQTVRVQFVGTTDSSLTTSFFVDDVTLQ
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggaacgatctggacgctggacaattcgtcgggtacggtctgcggtcattgcaacggtg
ttgagcacatcagtattgttaggcggctacgctgcctcagccaaagacaacaaaaaagtc
gaagtttatccgctccctgttgttgacgaaaagcaacctggttccgaacaattgccccca
ccagataaaattgtcggtggctcggcggctactgctggtgaattcccctggcaagctcgg
atagctcgtaacggcagcctacattgtggtggctcgttgattgctccccaatgggttttg
actgctgcgcactgtgttcaaggcttctcggtatcatcactcagcgtggtgatgggcgac
cataactggacgaccaacgaaggcaccgaacaaagccgcacaattgctcaagcagttgtt
cacccaagctacaattcatcaacctacgacaacgacattgctttgttgaaactcagcagc
gctgtaaccctcaacagccgcgttgccgtgattccgttcgccaccagcgctgatagcgcc
ttgtacaacgctggcgttgtttcaaccgtcactggttggggcgcgttgaccgaaggtggt
tcatcaccaaacgtcttgtacaaagtgcaagtgcctgtggtttcaaccgctacctgtaac
gcctcaaacgcctacaacggccaaatcactggcaacatggtgtgtgctggctacgctgct
ggcggcaaagactcatgccaaggcgatagcggtggtccattcgtcgctcaaagcagcggc
tcatggaaactcagcggtgttgtgagctggggcgatggttgtgcccgcgccaataagtat
ggcgtgtacaccaaagtttccaactacaccagctggatcaacagctatgtcggtacggta
accccaaccagcacgccagtgccaggtactccagtgccaaccagcacgccagtaccaggt
actccagtgccaaccagcacgccagtgccaggtggtagcttgcaaaatggtggcttcgaa
agcagcgctagctgggttcaatcaccaagcaatatcatctcaaccactcgcccacgcagc
ggctcgtatagcgccttcttgggtggctacaacagcggcaccgataacatctatcaaagc
gtgacggttccatcaaatggtgtgttgcgctactactggtacatgagcacccaagaaagt
ggcagcactgtctacgaccgcttgtatgttcgcctctacaacagcagcggcagcttgatc
accaccttgcgcacctggagcaacgcgagcaccaagaacacttggacgcttgacacgatt
agcctctcagcctacgctggccaaaccgtgcgtgtccaattcgttggcactaccgatagc
agcttgaccacctcgttcttcgtggacgatgtaactctgcaataa

DBGET integrated database retrieval system