KEGG   Hirschia baltica: Hbal_3076Help
Entry
Hbal_3076         CDS       T00945                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  
enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
hba  Hirschia baltica
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Biosynthesis of antibiotics
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:hba00001]
 Metabolism
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Hbal_3076
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Hbal_3076
  Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Hbal_3076
Enzymes [BR:hba01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Hbal_3076
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Hbal_3076
Lipid biosynthesis proteins [BR:hba01004]
 Fatty acid synthase
  Component type
   Hbal_3076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3374282..3375094)
Genome map
AA seq 270 aa AA seqDB search
MADWNFPKGDLMAGKRGLVMGVANQNSIAWGIAQQLAAQGAEMAFTYQGEALERRVRPLI
ESIGMDTMISADVTNDDEMDAAFATLKEKYGKLDFVVHAIAYAGKDELKGSMVHNTTREG
FARAMDISVFSFIDVCRRASEMMEEGGSIINLTYLGSERVIPSYNVMGVAKAGLEAATRY
AARDMGKQGVRVNAISAGPMRTLALMGIKGSKSLMSAGRDMSLLGEDTKMEGVAGAALYL
LSPIGASITGEVLHVDAGFHVVGVPEPSEE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcggactggaacttccctaaaggtgacttgatggctggcaagcgtggcttggtcatg
ggtgtcgcaaaccaaaactccattgcatggggtattgcccagcaattggccgcacagggt
gcggaaatggcttttacttatcaaggtgaagctttggagcgccgcgtacgtcccctgatt
gaatccatcggcatggacacgatgatttcagcggatgtgacaaatgatgatgagatggac
gcagcttttgcgacactcaaagaaaaatacggcaagttggatttcgttgttcacgcaatt
gcctatgctggcaaggatgagctgaaaggttccatggttcacaacacaacgcgtgaaggt
tttgcgcgtgcgatggatatttctgttttctcttttattgatgtatgtcgccgtgcttct
gaaatgatggaagagggtgggtctatcatcaacctgacttatcttgggtctgagcgtgtt
attccatcttacaatgtgatgggtgtggcaaaggctggacttgaagcggcgacacgctat
gccgcccgcgatatgggtaaacagggcgtgcgcgtgaacgcgatttctgcgggaccaatg
cggactttggcgttgatgggtattaaagggtctaagtctcttatgtctgctggacgtgat
atgtctcttttgggtgaagatacaaaaatggaaggtgtggctggagccgctctttatcta
ttgtctcctattggtgcttctatcacgggtgaagtgcttcacgtagatgcaggtttccat
gttgtgggtgtgcctgagccatctgaggaatag

DBGET integrated database retrieval system