KEGG   Hyphomonadaceae bacterium UKL13-1: AEM38_06195Help
Entry
AEM38_06195       CDS       T04338                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hbc  Hyphomonadaceae bacterium UKL13-1
Pathway
hbc00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hbc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AEM38_06195
Enzymes [BR:hbc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AEM38_06195
Transporters [BR:hbc02000]
 Other Transporters
  Pores ion channels [TC:1]
   AEM38_06195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_C GST_N GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AMS29135
UniProt: A0A142LA89
LinkDB All DBs
Position
1336523..1337110
Genome map
AA seq 195 aa AA seqDB search
MQIYGDDRSGNCLKVRWTAEHLNLPYVWHEVLALTGQTASPEFRALNPFGQVPVVRFDDG
RTLAQSNAIILYLAEGSSLIPADAFDRAKMFEWLFWEQYSHEVVIAVRRAKVHLLGQTDA
EIDPSLLPRGQVILSRMNEHLSERDWFVGTAFTLADMALLPYTRFADQGGFELHRYPAIQ
AWIRRCEGFLGLPAL
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcagatttatggcgatgatcgctcgggcaattgtttgaaagtgcgctggacggcggag
catttgaacttaccctatgtctggcacgaggtgttggccctgacaggccagacggcaagc
ccggaatttcgcgccctcaatccctttggccaagtgcccgtcgttcgttttgatgatggc
cgaacgctggcccaatccaacgccatcatcctctatctcgccgaagggtcgtccctgatc
ccggcagatgcgtttgaccgcgcgaaaatgttcgaatggctgttctgggagcaatatagc
cacgaggtggtcatcgcggtacggcgcgcgaaagtgcatttactcggccaaaccgatgct
gagattgacccaagccttctgccccgtgggcaagtcattctctcccgcatgaatgagcac
ttgagcgaacgggattggtttgtcggcaccgcctttactttggccgatatggcactgttg
ccatacacccgctttgccgatcagggcgggtttgaactgcatcgctatccagccattcag
gcttggatccggcggtgcgaaggctttttaggcctgcctgccttatag

DBGET integrated database retrieval system